SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000006447 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000006447
Domain Number 1 Region: 27-145
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000657
Family Growth factor receptor domain 0.0015
Further Details:      
 
Domain Number 2 Region: 129-181
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000262
Family TSP-1 type 1 repeat 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000006447   Gene: ENSSSCG00000006034   Transcript: ENSSSCT00000006623
Sequence length 228
Comment pep:known_by_projection chromosome:Sscrofa10.2:4:31802851:31966628:1 gene:ENSSSCG00000006034 transcript:ENSSSCT00000006623 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDYSHCQGNRWRRSKRASYVSNPICKGCLSCSKDNGCSRCQQKLFFFLRREGMRQYGECL
HSCPSGYYGHRAPDMNRCARCRIENCDSCFSKDFCTKCKIGFYLHRGRCFEECPDGFAPL
DETMECVEGCEVGHWSEWGTCSRNNRTCGFKWGLETRTRQIVKKPAKDTIPCPTIAESRR
CKMAMRHCPGGKRAPKAKEKKNKKKKRKLIDRAQEQHSVFLATDRANQ
Download sequence
Identical sequences ENSSSCP00000006447 ENSSSCP00000006447

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]