SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000006651 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000006651
Domain Number 1 Region: 134-231
Classification Level Classification E-value
Superfamily NSFL1 (p97 ATPase) cofactor p47, SEP domain 4.58e-33
Family NSFL1 (p97 ATPase) cofactor p47, SEP domain 0.0000136
Further Details:      
 
Domain Number 2 Region: 215-328
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.64e-29
Family UBX domain 0.0000484
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000006651   Gene: ENSSSCG00000006239   Transcript: ENSSSCT00000006837
Sequence length 331
Comment pep:novel chromosome:Sscrofa10.2:4:81204554:81232222:-1 gene:ENSSSCG00000006239 transcript:ENSSSCT00000006837 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEGGGGEAGEEEPRTPGPRPPSARDLQLALAELYEDEVKCKASKPDRPKATGFKSPRTP
PQRFYSSEHGYSGLHIVRPSTGKIVNELFKEAREHGAVPLNEATRASGDDKSKSFTGGGY
RLGNSFCKRSEYIYGESQLQDVQILLKLWSNGFSLDDGELRPYSDPTNAQFLESVKRGEI
PLELQRLVRGGHVNLDMEDHQDQEYVKPRLRFKAFSGEGQKLGSLTPEIVSTPSSPEEEE
KSLLSAVVLIDDSVPTTKIQIRLADGSRLIQRFNSTHRILDVRDFIVQSRPEFATLDFIL
VTSFPNKELTDESLTLQEADILNTVILQQLK
Download sequence
Identical sequences A0A287AXD2
ENSSSCP00000006651 XP_001925017.1.46622 9823.ENSSSCP00000006651 ENSSSCP00000006651

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]