SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000007058 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000007058
Domain Number 1 Region: 154-270
Classification Level Classification E-value
Superfamily PX domain 3.4e-25
Family PX domain 0.0017
Further Details:      
 
Domain Number 2 Region: 39-137
Classification Level Classification E-value
Superfamily PDZ domain-like 1.08e-24
Family PDZ domain 0.0068
Further Details:      
 
Domain Number 3 Region: 274-341
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000182
Family Ubiquitin-related 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000007058   Gene: ENSSSCG00000006619   Transcript: ENSSSCT00000007253
Sequence length 541
Comment pep:known_by_projection chromosome:Sscrofa10.2:4:106665129:106748521:1 gene:ENSSSCG00000006619 transcript:ENSSSCT00000007253 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADEDGEGIHPAAPHRNGGGGGGGGSGLHCAGNGGGGGGGPRVVRIVKSESGYGFNVRGQ
VSEGGQLRSINGELYAPLQHVSAVLPGGAADRAGVRKGDRILEVNGVNVEGATHKQVVDL
IRAGEKELILTVLSVPPHEADNLDPSDDSLGQSFYDYTEKQAVPISVPTYKHVEQNGEKF
VVYNVYMAGRQLCSKRYREFAILHQNLKREFANFTFPRLPGKWPFSLSEQQLDARRRGLE
EYLEKVCSIRVIGESDIMQEFLSESDENYNGVSDVELRVALPDGTTVTVRVKKNSTTDQV
YQAIAAKVGMDSTTVNYFALFEVINHSFVRKLAPNEFPHKLYVQNYTSAVPGTCLTVRKW
LFTTEEEILLNDNDLAVTYFFHQAVDDVKKGYIKAEEKSYQLQKLYEQRKMVMYLNMLRT
CEGYNEIIFPHCACDSRRKGHVITAISITHFKLHACTEEGQLENQVIAFEWDEMQRWDTD
EEGMAFCFEYARGEKKPRWVKIFTPYFNYMHECFERVFCELKWRKENIFQMARSQQRDVA
T
Download sequence
Identical sequences F1ST14
9823.ENSSSCP00000007058 ENSSSCP00000007058 XP_003125809.1.46622 ENSSSCP00000007058

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]