SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000008337 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000008337
Domain Number 1 Region: 341-420
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000000305
Family Ubiquitin-related 0.0031
Further Details:      
 
Domain Number 2 Region: 257-336
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000073
Family Ubiquitin-related 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000008337   Gene: ENSSSCG00000007808   Transcript: ENSSSCT00000008556
Sequence length 421
Comment pep:known_by_projection chromosome:Sscrofa10.2:3:18796319:18810914:1 gene:ENSSSCG00000007808 transcript:ENSSSCT00000008556 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEPLRKRGRRSRGGGVGRGTRGSRGGRGRRPQSQRSPARRTLDPELVDLVSDSDEDVLE
VATARGAADPAEVPLPETPVPAAPRDDSDSDSEGADAGPAGAPPILIRRRRRLLLDPGEA
PAVPVYSEKVKSSLHLIPDHVSLLKFCPPETEEEAESVDVADASSPHAEDSPCPASPWKR
KLRSMDGEEKKKVLLVQDASPVTPPPPRTKSRKHSRALQKLREVNKRLQDLRSCLSPKQP
QGQDHLSQEDEVVLVEGPPLPENPRLLPLKIRCRADLVRLPVRMSEPLQSVVDHMATRLG
VSPSRILLLFGETELSPTATPRTLKLGVADIIDCVVLASSPEAAGTSQLIQLRVQGKEKH
QMLEVSLPRDSPLKTLMSRYEEAMGLSGCKLTFFFDGTKLSGKELPADLGMESGDLIEVW
G
Download sequence
Identical sequences ENSSSCP00000008337 ENSSSCP00000008337

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]