SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000009475 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000009475
Domain Number 1 Region: 377-543,841-1059,1114-1167
Classification Level Classification E-value
Superfamily Ras GEF 1.7e-114
Family Ras GEF 0.00011
Further Details:      
 
Domain Number 2 Region: 525-610
Classification Level Classification E-value
Superfamily PDZ domain-like 2.76e-18
Family PDZ domain 0.0041
Further Details:      
 
Domain Number 3 Region: 255-380
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.00000000000000314
Family cAMP-binding domain 0.0008
Further Details:      
 
Domain Number 4 Region: 3-109
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.00000000000432
Family cAMP-binding domain 0.0024
Further Details:      
 
Domain Number 5 Region: 751-830
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000543
Family Ras-binding domain, RBD 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000009475   Gene: ENSSSCG00000008881   Transcript: ENSSSCT00000009724
Sequence length 1625
Comment pep:known_by_projection chromosome:Sscrofa10.2:8:50390540:50684112:1 gene:ENSSSCG00000008881 transcript:ENSSSCT00000009724 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKNPAERTPQDLEIVYSYLHGMEALSNLREHQLRLMCETVRYERHEANEVLYYPDDIGTC
WYILLSGSVFIKESMFLPRSSFGKRSAGSFRRGCECIVLEPSEMIVVDYMDENEEYFQRQ
ASHRQSRRRFRKINQKGERQTIIDTVDPYPVGKPPLPRGYHTLPADFTKLHLTDSLHPQV
THVSSSHSGCSITSDSGSSSLSDIYQATESEAGDMDLSGLPETAVDSEDDDDEEDIERAS
DPLMSRDIVRDCLEKDPIDRTDDDIEQLLEFMHQLPAFANMTMSVRRELCAVMVFAVVER
AGTIVLNDGEELDSWSVILNGSVEVTYPDGKAEILCMGNSFGVSPTMDKEYMKGVMRTKV
DDCQFVCIAQQDYCRILNQVEKNMQKVEEEGEIVMVKEHRELDRTGTRKGHIVIKGTSER
LTMHLVEEHSVVDPTFIEDFLLTYRTFLCSPMEVGKKLLEWFNDPSLRDKVTRVVLLWVN
NHFNDFEGDPAMTRFLEEFENNLEREKMGGHLRLLNIACAAKAKRRLMTLTKPSREAPLP
FILLGGSEKGFGIFVDSVDSGSKATEAGLKRGDQILEVNGQNFENIQLSKAMEILRNNTH
LSITVKTNLFVFKELLTRLSEEKRNGAPHLPKIGDIKKASRYSIPDLAVDVEQVIGLEKV
NKKSKANTVGGRNKLKKILDKTRISILPQKPYNDIGIGQSQDDSIVGLRQTKHIPAALPV
SGTLSSSNPDLLQSHHRILDFSTTPDLPDQVLRVFRADQQSRYIMISKDTTAKEVVIQAI
REFAVTATPDQYSLCEVSVTPEGVIKQRRLPDQLSKLADRIQLSGRYYLKNNMETETLCS
DEDAQELLRESQITLLQLSTVEVATQLSMRNFELFRNIEPTEYIDDLFKLKSKTSCANLK
KFEEVINQETFWVASEILRETNQLKRMKIIKHFIKIALHCRECKNFNSMFAIISGLNLAP
VARLRTTWEKLPNKYEKLFQDLQDLFDPSRNMAKYRNVLNSQNLQPPIIPLFPVIKKDLT
FLHEGNDSKVDGLVNFEKLRMIAKEIRHVGRMASVNMDPALMFRTRKKKWRSLGSLSQGS
TNATVLDVAQTGGHKKRVRRSSFLNAKKLYEDAQMARKVKQYLSNLELEMDEESLQTLSL
QCEPATNTLPKNPGDKKPVKSETSPVAPRAGSQQKTQPQPPPQPQPLPHKMNQGLQVPAV
SLYPSRKKVPVKDLPPFGINSPQALKKILSLSEEGSLERHKKPAEDTISNASSQLSSPPT
SPQSSPRKGYTLAPSGTVDNFSDSGHSEISSRSSLVSNSSFDSVPVSLPEERRQRHSVSL
VERRPVLEPDQYSLGSCVPVSESRGLYATATVIFSPSTEELSQDQGDRASLDAADSGRGS
WTSCSSGSHDNIQTIQHQRSWETLPFGHTHFDYSGDPAGLWASSSHMDQIMFSDHSTKYS
RQNQSRESLDQAQSRASWASSTGYWGEDSEGDTGTIKRRGGKDVCIEAESSSVTSVTTEE
AKPVPVPTHMAVTPGTAKGLIARKEGRYREPPPTPPGYVGIPITDFPEGHPHPARKPPDY
TVALQRSRMLARPADPAAPPAPGSARPAPRPQWHRPGDGDPRPGPCPPPGLAAEEDAEDE
QVSAV
Download sequence
Identical sequences ENSSSCP00000009475 ENSSSCP00000009475

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]