SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000009731 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000009731
Domain Number 1 Region: 410-798
Classification Level Classification E-value
Superfamily Ankyrin repeat 7.58e-131
Family Ankyrin repeat 0.000000000348
Further Details:      
 
Domain Number 2 Region: 166-428
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.66e-73
Family Ankyrin repeat 0.000003
Further Details:      
 
Domain Number 3 Region: 13-235
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.63e-55
Family Ankyrin repeat 0.0000175
Further Details:      
 
Domain Number 4 Region: 3505-3617
Classification Level Classification E-value
Superfamily DEATH domain 1.24e-25
Family DEATH domain, DD 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000009731   Gene: ENSSSCG00000009125   Transcript: ENSSSCT00000009992
Sequence length 3896
Comment pep:known_by_projection chromosome:Sscrofa10.2:8:117354892:117671790:-1 gene:ENSSSCG00000009125 transcript:ENSSSCT00000009992 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERKRKSDSNASFLRAARAGNLDKVVEYLKGGIDINTCNQNGLNALHLAAKEGHVGLVQE
LLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENH
IDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKVRLPALHIAARK
DDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFT
ARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERG
APLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTK
LLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMG
HLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLH
IASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKK
GFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASP
HATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLL
DKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVK
MVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAK
RLGYISVVDTLKVVTEEVTTTTTTITEKHKLNVPETMTEVLDVSDEEGDDTMTGDGGEYL
RPEDLKELGDDSLPSSQFLDGMNYLRYSLEGGRSDSLRSFSSDRSHTLSHASYLRDSAMI
DDTVVIPSHQVSALAKEAERNSYRLSWGTENLDNVALSSSPIHSGFLVSFMVDARGGAMR
GCRHNGLRIIIPPRKCTAPTRVTCRLVKRHRLATMPPMVEGEGLASRLIEVGPSGAQFLG
PVIVEIPHFAALRGKERELVVLRSENGDSWKEHYCEYTEDELNEILNGMDEVLDSPEDLE
KKRICRIITRDFPQYFAVVSRIKQDSNLIGPEGGVLSSTVVPQVQAVFPEGALTKRIRVG
LQAQPMHSELVKKILGNKATFSPIVTLEPRRRKFHKPITMTIPVPKASSDVMLNGFGGDA
PTLRLLCSITGGTTPAQWEDITGTTPLTFVNECVSFTTNVSARFWLIDCRQIQESVTFAS
QVYREIICVPYMAKFVVFAKSHDPIEARLRCFCMTDDKVDKTLEQQENFAEVARSRDVEV
LEGKPIYVDCFGNLVPLTKSGQHHIFSFFAFKENRLPLFVKVRDTTQEPCGRLSFMKEPK
STRGLVHQAICNLNITLPIYTKESESDQEQEEEIDMTSEKNDETESTETSVLKSHLVNEV
PVLASPDLLSEVSEMKQDLIKMTAILTTDVSDRAGSLKVKELVKAAEEEPGEPFEIVERV
KEDLEKVNEILRSGTCAGDEGSEPRSQPEREVVEEEWVIVSDEEIEEAKRKAPLEITEYP
CVEVRLDKDTKVKVEKDSLGLVNYLTEDLNSYVPPHGEPLQMERELAGEKQEALGPGRSS
ESEGKDAPSEETQSTQKQPKPSLGIKKPVRRKLKDKQKQKEDSSQASADKSELKKGSSEE
SLDEDTGLAPEPLPAVKATSPLIEETPIGSIKDKVKALQKRVEDEQKGRSKLPVRVKGKE
DVPKKITHRTQLAASPSLKSERHALASKPERHSSLSSPAKTERHPPVSPSSKTEKHSPVS
PSAKTERHSPVSSSSKTEKHSPVSPSTKPDRHSPVSSATKTERHPPVSPSGKTDKRPPVS
PSGRTEKHPPVSPGRTEKRLPVSPAGRMERHSPVSTSGKTEKHLPVSPSGKTDKQPPVSP
TSKTERIEETMSVRELMKAFQSGQDPSKHKTGLFEHKSAKQKQPQEKGKVRGEKEKGLTV
TQKETQKTETQTIKRSQRFLVTGPPESRRAARASSIGLKREEGAGERGKALNHKTPEPVQ
SAPEEESHKVESPKEKLADEQGDMDLQISPDRKTSTDFSDVIKQELEDNDKYQEFCHSEE
TEKAQLHLDQVLTSPFNTTFPLDYMKEEFLPALSLQSGALDGSSESLKHEGAAGSPCGSL
MEGTPQISSEESYKHEGLAETPETSPESLSFSPKKTEEQTEETKETTKVESPPEIHSEKE
DPSTKDVTDSSAGQGAVVTGGTEPSAECLLKEATLEPSKDTCPQPEDEGLDSQGESLAKE
TPKGLTEGVPHGEDPLTHVSSAHEKQTDTEAQKSTASKPSDETAASPLPDAVVKTSPGTE
SKPQGVIRSPQGLELALPSRDSEVFSPGADESFAVSHKDSLEASPVLEDNSSHKTPDSLE
PSPLKESPCRDSLESSPVEPKMKAGILPSQFPLPSAVAKTELITEVASMRSRLLRDPDGS
AEDDSLEQTSLMESSGKSPLSPDTPSSEEISYEVTPKTTDAGTPKPAVIPECAEEDDLEN
GEKKRFTPEEEMFKMVTKIKMFDELEQEAKQKRDYKKEPKQEDSSSSSDADVECSADLDE
PKCMESVEDKSNAPVVVTAESRKASSSSESEPELTQLKKGADSGLLPEPVIRVQPPSPLP
SSIDSNSSPEEVQFQPIVSKQYTFKMNEDTQEDSGKSEEEEGCESHLPEDSHTVSTSGPE
MSYDDVNRDADQPKICGSYGCEAESPSSSAIPVTLGLHSSTGEDVREQLVIHKEPLARQD
TGEKDTEGEELDVSRVEAPQVGYPTESSSSSSSLPHCPASEGKELDEDVVSTSSATKMEV
TKADQAFESLPDDYSTQDLPNTTQTDSSSLDVPVSDPTETDDISDPQVTSPYENVPSQSF
FSSEESKTQTDTRHTSFHSSEVCSVTTTSSVEEVVVTSSSGRTVSSQESNLEDQNLECKQ
ESPLCEVQPDGAPSSLEPAAPTTSTVVGEQISKVIITKTDVDSDSWSEIREDDEAFEARV
KEEEQKIFGLMVDRQSQGTTPDTTPARTPTEEGTPTSEQNPFLFQEGKLFEMTRSGAIDM
TKRSYGDESFHFFQIGQESREETLTEDMKEGGTGTELPQLETSAESLAPLESKETVNDEA
DLVPDDLSEEVEEVPTSDGQLNSQMGISASTETSMKEAASAGAEDLPCIQMSDTPSLSLV
KQAACPDSPEPVVQVQLDFSTVTRSVYSDRDDESPDSSPEEQKSVIEIPTAPMENVPSTE
SRSKIPVRTMPTSTPAFPSMECESAPSEGFLPSLDEESQEDETKPKSKIPVKAPVPRVEQ
QLLHLDSSLQETVAPQGQDVTSRAPDSRSKSESDASPLDAKITCPEKTGSYTETDLESSE
GTEELELESEDETTRPKIFASRLPVKSKSITSSCRGATSPTKESKEHFFDLYRNSIEFFE
EISDEASKLVDRLTQSEREQELVSDDESSSALEVSVIENLPPVETEQSIPEDIFDTRPIW
DESIETLIERIPDENGHDHAEDQQDEQERIEERLAYIADHLGFSWTELARELDFTEEQIH
QIRIENPNSLQDQSHALLKYWLERDGKHATDTNLIECLTKINRMDIVHLMETITEPLQER
ISHSYAEIEQTITLDHSEGFSVLQEELCTAQNKQKEEQAASKEGESYDHPPIVSEEDISV
GYSTFQDSIPKTEGDGSVTELLPKTHEEQVQQDFSGKMQDLEESSLEQQEYFVTTPGTEA
SETPKATAAPGSPSKTPEEIITPPEEERPYLQTPTASEQGDSPIVQEPEEPPEHREASLP
QKTSLVIVESADDQPQTFERLDEDAAFQKGDDMPDIPPETVTEEEYVDEHGHTVVKKVTR
KIIRRYVSSDGTEKEEMTMQGAPQDPISIEEGDGYSKVIKRVVLKSDTERSEVRAD
Download sequence
Identical sequences ENSSSCP00000009731 ENSSSCP00000009731

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]