SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000009827 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000009827
Domain Number 1 Region: 644-780
Classification Level Classification E-value
Superfamily EF-hand 0.00000000265
Family Calmodulin-like 0.034
Further Details:      
 
Domain Number 2 Region: 474-527,564-688
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00000000863
Family Voltage-gated potassium channels 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000009827   Gene: ENSSSCG00000009217   Transcript: ENSSSCT00000010093
Sequence length 970
Comment pep:known_by_projection chromosome:Sscrofa10.2:8:140235497:140289084:-1 gene:ENSSSCG00000009217 transcript:ENSSSCT00000010093 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVNSSRVQPQQPGDAQRPAAPRTAGPGRLMAGGGAAGAGLAAPGGLREQRGLEIEMERIR
QAAARDPPAGASASPSPPLSSCSRQAWSRDNPGFEAEEEEEEDEVEGEEGGMVVEMDVEW
RPGSRRSAASSAVSSAGARGRGLGSFHGAGHPSGRRRRREDQGPPSPSPAGGGDPLHRHL
PLDGQPPRVAWAERLVRGLRGLWGTRLMEESSTDRERYLKSVLRELATYLLFLIVLCVLT
YGMMSSSVYYYTRIMSQLFLDTPVSRTEKTNFKTLSSVEDFWKFAEGALLDGLYWKTQPS
NGTEAHNRSFIYYENLLLGVPRIRQLRVRNGSCSIPQDLRDEIKECYDVYSVSSEDRAPF
GPRNGTAWIYTSEKDLNGSSHWGMLTTYSGAGYYLDLSRTREETAAQLAHLRKHAWLDRG
TRAMFIDFSVYNANINLFCVIRLLVEFPATGGVIPSWQFQPVKLIQYVTTFDFFLAACEI
IFCFFILYYVVEEILEIRIHKLHYFRSFWNCLDVVIIVLSVAAIGINIHRTSNVEMLLQF
LEDQNTYPNFENLAYWQIQFNNIAAVIVFFVWIKLFKFISFNRTMSQLSTTMSRCAKDLF
GFAIMFFIIFLAYAQLAYLVFGTQVDDFSTFQECIFTQFRIILGDINFAEIEEANRVLGP
IYFTTFVFFTFFILLNMFLAIINDTYSEVKSDLAQQKAEMELSDLIRKGYHKALVKLKLK
KNTVDDISESLRQGGGKLNFDELRQDLKGKGHTDAEIEAIFTKYDQDGDQELTEREHQQM
RDDLEKEREDLDLEHSSLPRPMSSRSFPRSLDDSEEDDDDDSGHSSRRRGSISSGVSYEE
FQVLVRRVDRMEHSIGSIVSKIDAVIVKLEIMERNKLKRREVLGRLLDGVAEDERLGRDS
EIHREQMERLVREELERWESDDAASQISHGLGTPVGLNGQPRPRSSRPSSSQSTEGMEGG
GGNGSADIHV
Download sequence
Identical sequences ENSSSCP00000009827 9823.ENSSSCP00000009827 ENSSSCP00000009827

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]