SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000010783 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000010783
Domain Number 1 Region: 5-67
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.32e-25
Family KRAB domain (Kruppel-associated box) 0.00091
Further Details:      
 
Domain Number 2 Region: 303-360
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.14e-24
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 3 Region: 247-304
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.65e-23
Family Classic zinc finger, C2H2 0.0085
Further Details:      
 
Domain Number 4 Region: 210-261
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.4e-16
Family Classic zinc finger, C2H2 0.008
Further Details:      
 
Domain Number 5 Region: 350-382
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000617
Family Classic zinc finger, C2H2 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000010783   Gene: ENSSSCG00000010110   Transcript: ENSSSCT00000011071
Sequence length 382
Comment pep:novel chromosome:Sscrofa10.2:14:54484073:54486063:-1 gene:ENSSSCG00000010110 transcript:ENSSSCT00000011071 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KTCVSFQESVTFKDVAVDFTQEEWGQLDSPQRALYRDVMLENYQNLLSLVGPPVCKPDVI
SHLERGEEPWQVPRDVPAGARSEQGPRPETEEPWSQQPGVHKEEPSWEPIEKRLARSGLH
NHGLDGRGTWGGPVTALSQDKAASTWNVSMDKHWRGHAVSEKDSHLRCTLLTQPGIPAGG
SSPDHLVDSLRSSGAGSRHHVGRRSCGSGLFTCGECGKAFHQSAALALHRRWHAREKAYK
CGECGKAFPWSTNLLEHQRVHTGEKPFFCGACGKAFSCHSSLNVHQRVHTGERPYKCGAC
EKAFSCSSLLNMHLRVHTGEKPYKCGECGKAFNQRTHLTRHHRIHTGEKPYTCSACGKAF
TCHSSLTVHEKIHNGDKPFKCS
Download sequence
Identical sequences ENSSSCP00000010783 ENSSSCP00000010783 9823.ENSSSCP00000010783

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]