SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000010784 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000010784
Domain Number 1 Region: 101-263
Classification Level Classification E-value
Superfamily C-type lectin-like 3.67e-19
Family C-type lectin domain 0.0055
Further Details:      
 
Domain Number 2 Region: 24-64
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000471
Family LDL receptor-like module 0.0012
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000010784
Domain Number - Region: 262-327
Classification Level Classification E-value
Superfamily FnI-like domain 0.00115
Family VWC domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000010784   Gene: ENSSSCG00000010111   Transcript: ENSSSCT00000011072
Sequence length 547
Comment pep:known_by_projection chromosome:Sscrofa10.2:14:54387653:54417873:-1 gene:ENSSSCG00000010111 transcript:ENSSSCT00000011072 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ALPAWVCATMFLPPYLSLALRSTELRCNPGQFACRSGAIQCIPLPWQCDGWVTCEDESDE
ADCPEVIGESRPYHGKEAVDPRQGRARGGDPTHFHTMNVAQPVRFSSFLGKCPTGWHHYE
GTASCYRVYLSGENYWDAAQTCQRVNGSLAIFSTDQELRFVLAQEWDQPERSFAWQDQHK
LWVGYQYVFTGRNSSLEGHWEVAFKGSPEVLLPPDPGLAAAASDNNVVLCAQLQRFHFPT
LRHRDLHSWRAESCQDKSSFLCKRSQTCVDIKDNVVDEGFYFTPKGDDPCLSCTCHRGEP
EMCVAALCERPQGCQQYRKDPKECCKFMCLDPDGSSLLDSMASGMRLVVSCVSSFLILSL
LLFMVHRLRQRRRERIESLIGANLHHFNLGRRIPGFDYGPDGFGTGLTPLHLSDDGEGGT
FHFHDPPPPYTAYKYPDIDQPDDPPPPYEASINPDSVFYDPADDDTFELAEATPPTTGDG
GEEGAAPRCLEQPLPPPGASLADLEDSADSSSILLVPPDPTQSGSSPTTEALPVGGRHSR
SSLNTVV
Download sequence
Identical sequences ENSSSCP00000010784 ENSSSCP00000010784

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]