SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000010872 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000010872
Domain Number 1 Region: 516-573
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.24e-26
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 2 Region: 908-965
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.02e-25
Family Classic zinc finger, C2H2 0.007
Further Details:      
 
Domain Number 3 Region: 2-62
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.1e-24
Family KRAB domain (Kruppel-associated box) 0.00089
Further Details:      
 
Domain Number 4 Region: 573-629
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.48e-24
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 5 Region: 852-909
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.7e-24
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 6 Region: 628-685
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.71e-23
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 7 Region: 460-517
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.38e-22
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 8 Region: 796-853
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.98e-22
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 9 Region: 954-1006
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.92e-20
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 10 Region: 408-461
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.39e-17
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 11 Region: 684-742
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000281
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 12 Region: 354-404
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000469
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 13 Region: 731-788
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000202
Family Classic zinc finger, C2H2 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000010872   Gene: ENSSSCG00000010196   Transcript: ENSSSCT00000011162
Sequence length 1013
Comment pep:novel chromosome:Sscrofa10.2:14:65796609:65894063:1 gene:ENSSSCG00000010196 transcript:ENSSSCT00000011162 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLFQGPVTFKDITVEFTQEEWQLLDNAQRTLYREVMQENYHHLISVGYCVNKPNAVFKLK
QGKEPWILEVEFPRRNNPGNFKCRVLSKMIEDTSSAYVSNINHISCFHSLHSDSLFCLTF
YFNLDLNFFFPRIPSYFLLLKYAASVLISCSLFKTQKSDYKLLCLSSIVAPKHVPIFASS
AFSLHLKMNKYEGNTVWEMQCLVVSSENLWYYILSRLLCMSKEEKTYGIFMTKEQNIRKV
KLKIQEFNFEIRSFVRKGLNGRAPVNTKCEKTNTELYNNRGFIALSVEFRQLRGPVNIIQ
VPSTRCYTTINPMNLMNIGKICRNQFSQSLLENIHNRPKKKKKKKKINELGTFFSRNGEL
TKPQETLTREKTYKCNECGKSFCQKSILTIHQHTHSKDKPSECGKSRNEDLTRQQKTNTR
EKTYECKECKKTFYHLSSLSRHLRTHAGEKPYECNQCEKSFYQKPHLMEHQKTHTGEKPY
ECTECGKFFYVKAYLMVHQKTHTGEKPYECKECRKSFSQKSHLTVHQRTHTGEKPYKCKE
CGKFFSRNSHLKTHQRTHTGEKPYECKECGKCFYQKSALTVHQRTHTGEKPFECNKCGKN
FYYKSDLTKHQRKHTGEKPYECNECGKSFSVNSVLRLHQRTHTGEKPYECKECGKSFSQK
SHFVIHQRKHTGEKPFECQECKKTFFQKSKLTAHQKTHTEGETLCKYNECGRTFIQSLKL
NLSQRTHLEMEPYECSICGKSFYMDLRMGHQRALTRDCPYEYNEYGQIFCENSTFVIHQI
VHMGVKPYEHNENGNTFNKKSHLTQLRRAHSGEKTFECGECGKTFWEKSNLTQHQRTHTG
EKPYECTECGKSFCQKPHLTNHQRTHTGEKPYECKQCGKTFCVKSNLTEHQRTHTGEKPY
ECNACGKSFCHRSALTVHQRTHTGEKPFICNECGKSFCVKSNLIVHQRTHTGEKPYKCNE
CGKTFCEKSALTKHQRTHTGEKPYECNGCGKTFSQRSVLTKHQRIHTRVKALS
Download sequence
Identical sequences ENSSSCP00000010872 ENSSSCP00000010872

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]