SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000011675 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000011675
Domain Number 1 Region: 21-331
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.61e-122
Family Papain-like 0.000000000237
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000011675   Gene: ENSSSCG00000010948   Transcript: ENSSSCT00000011983
Sequence length 332
Comment pep:known_by_projection chromosome:Sscrofa10.2:10:31907424:31913492:-1 gene:ENSSSCG00000010948 transcript:ENSSSCT00000011983 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNPSLLLAAFCLGIASAAPRHDHSLDADWYKWKATHRKLYGLNEEGRRRAIWEKNMKMIE
RHNWEHRQGKHSFTMAMNAFGDMTNEEFRKTMNGFQNQKHKKGKVFLDAGSALTPHSVDW
REKGYVTAVKNQGHCGSCWAFSATGALEGQMFRKTSKLISLSEQNLVDCSWPEGNEGCNG
GLMDNAFQYIKDNGGLDSEESYPYFGKDGSCKYKPQSSAANDTGYVDIPKQEKALMKAVA
TVGPISVGIDASHESFQFYSTGIYFEPQCSSEDLDHGVLVVGYGVEGAHSNNKYWLVKNS
WGNTWGMDGYIKMTKDQNNHCGIATMASYPVV
Download sequence
Identical sequences ENSSSCP00000011675 ENSSSCP00000011675 9823.ENSSSCP00000011673 9823.ENSSSCP00000011675

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]