SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000012269 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000012269
Domain Number 1 Region: 200-352
Classification Level Classification E-value
Superfamily PH domain-like 1.57e-32
Family Third domain of FERM 0.0015
Further Details:      
 
Domain Number 2 Region: 90-198
Classification Level Classification E-value
Superfamily Second domain of FERM 1.14e-22
Family Second domain of FERM 0.0017
Further Details:      
 
Domain Number 3 Region: 4-90
Classification Level Classification E-value
Superfamily Ubiquitin-like 9.09e-21
Family First domain of FERM 0.003
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000012269
Domain Number - Region: 438-501
Classification Level Classification E-value
Superfamily Prefoldin 0.0706
Family Prefoldin 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000012269   Gene: ENSSSCG00000011511   Transcript: ENSSSCT00000012598
Sequence length 982
Comment pep:known_by_projection chromosome:Sscrofa10.2:13:55733974:55875266:-1 gene:ENSSSCG00000011511 transcript:ENSSSCT00000012598 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QMTEGRHCQVHLLDDRRLELLVQPKLLSRELLDLVASHFNLKEKEYFGITFTDDTGQQNW
LQLDHRVLDHDLPKKPGPTILYFSVRFYIESISFLKDKTTVELFFLNAKSCVHKGQIEVD
SETIFRLAALVLQEAKGDYISDENARKDLKTLPAFPTKTLQEHPSLAYCEDRVIEHYLKI
KGLTRGQAVVQYMKIVEALPTYGVHYYAVKDKQGLPWWLGISYKGIGQYDLQDKVKPRKL
FQWKQLENLYFREKKFAVEVHDPRRISVSRRTFGQSGLFVQTWYANSSLIKSIWVMAISQ
HQFYLDRKQSKAKIPSARSLDDIAMDLTETGAPRVSKPVTLEAKSQFIMASNGSLISSGS
QDSEVSEEQKREKILELKKKEKLLQEKLLKKVEELKKICLREAELTGKIPKEYPLNVGEK
PPQVRRRVGTAFKLDDNLLPSEEDPALQELESNFLIQQKLVEAAKKLANEPDLCKTVKKK
RKQDYTDAVKKLQEIENAINEYRIRCGKKPSQKATVTLPEDIIPSESSSLSDTTTYDDSN
DTFNLSGQRSSSVPHSPRILPPKSLGIERIHLRKSSVNEQLVDTRQSREMLSTHSSPYKT
LERRPQGGRSMPTTPVLTRNAYSSSHLEPESSSQHCRQRSGSLESQSHLLSEMDHDKPFF
SLSKSQRSSSTEILDDGSSYTSQSSTEYYCVTPVAGPYYTTQTLDTRSRGRRRSKKQNVS
TSNSGSMPNLAQKDSLRNGVYSKSQEQTSSSYYIAGYTPYAECDLYYSGGYVYENDMEGQ
YSVNPSYRSSAHYGYDRPRDYSRSFHEDEVDRVPHNPYATLRLPRKAAAKSEHITKNIHK
ALVAEHLRGWYQRASGQKEQSHSTQTSFDSDRGSQRSLGFAGLQVPCSPSSRASSYSSVS
STNASGNWRTQITVGLSEYETPAHPSYTSCYGNIYNPLSSPGRQYTETSQLDGTDGSRLE
DSLESSEQRLFWHEDSKPGTLV
Download sequence
Identical sequences ENSSSCP00000012269 ENSSSCP00000012269

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]