SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000013768 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000013768
Domain Number 1 Region: 155-458
Classification Level Classification E-value
Superfamily Cysteine proteinases 5.26e-97
Family Papain-like 0.00000000356
Further Details:      
 
Domain Number 2 Region: 29-113
Classification Level Classification E-value
Superfamily Cystatin/monellin 0.0000612
Family Cystatins 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000013768   Gene: ENSSSCG00000027368   Transcript: ENSSSCT00000014154
Sequence length 460
Comment pep:known chromosome:Sscrofa10.2:2:4930949:4936147:1 gene:ENSSSCG00000027368 transcript:ENSSSCT00000014154 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPWLQLLLLLGLLPDAAPAPKKPRAAGPQARELASPELLAPARFALEMYNRGRAAGTRA
ALRAVRGRVRRAGRGSLYSLKATLVEPPCNDPTVCQLPISKKTLLCSFEVLDELGKHMLL
RRDCGPVDTKVTDDTNETFSSFLPLLNKDPLPQDFSVKMASIFKEFVTTYNRTYDTKEEA
RWRMSVFANNMVRAQKIQALDTGTARYGVTKFSDLTEEEFRTIYLNPLLQEEPGRKMRLA
KSVSSLPPPEWDWRKKGAVTKVKDQGMCGSCWAFSVTGNVEGQWFLKQGTLLSLSEQELL
DCDKVDKGCMGGLPSNAYSAIKTLGGLETEEDYSYRGHLQTCSFNAEKAKVYINDSVELS
QNEQKLAAWLAEKGPISVAINAFGMQFYRHGISHPLRPLCSPWLIDHAVLLVGYGNRSAT
PFWAIKNSWGTDWGEEGYYYLYRGSGACGVNIMASSAVVN
Download sequence
Identical sequences ENSSSCP00000013754 ENSSSCP00000013768 9823.ENSSSCP00000013754 9823.ENSSSCP00000013768 ENSSSCP00000013754 ENSSSCP00000013768

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]