SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000014364 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000014364
Domain Number 1 Region: 416-623
Classification Level Classification E-value
Superfamily PUA domain-like 1.02e-76
Family SRA domain-like 0.00000000357
Further Details:      
 
Domain Number 2 Region: 12-89
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.37e-18
Family Ubiquitin-related 0.0000242
Further Details:      
 
Domain Number 3 Region: 733-795
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000299
Family RING finger domain, C3HC4 0.011
Further Details:      
 
Domain Number 4 Region: 332-386
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000215
Family PHD domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000014364   Gene: ENSSSCG00000013517   Transcript: ENSSSCT00000014764
Sequence length 813
Comment pep:known_by_projection chromosome:Sscrofa10.2:2:74678784:74711249:-1 gene:ENSSSCG00000013517 transcript:ENSSSCT00000014764 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GVLPLPSHLAPAGIMWIQVRTMDGKVAHTVNSLSRLTKVENLRRRIQEVFHVEPGLQRLF
YRGKQMEDGHTLFDYDVRLNDTIQLLVRQSPMLSPGSSKERDSELSDTDSGCCLGQSESD
KSSNSGEAANEPEVKADEDTWDETELGLYKAGEYVDARDTNMGAWFEAQVIRVTKKTVAQ
DRPCSSSSSSSSTLEDDVIYHVKYEDYPENGVVQLSSRDVRARARQILKWHELEVGQVVM
LNYNTDSPKDRGFWYDAEILRKRETRTARELHANVRIGDDSLNDCRIIFVDEVFKIERPG
EGSPLVETPVRRKSGPTCKHCKDNPRKLCRMCACRLCGGKQDPDKQLMCDECDMAFHMYC
LCPPLSSVPSEAEWYCPECRIDSSEVVQAGEKLKESKKKAKMASATSSSQRDWGKGMACV
GRTKECTIVPSNHYGPIPGIPVGTMWRFRVQVSESGVHRPHVAGIHGRSNDGAYSLVLAG
GYEDDVDHGNSFTYTGSGGRDLSGNKRTAEQSCDQKLTNTNRALALNCFAPINDRKGAEA
KDWRSGKPVRVVRNVKGRKHSKYAPVEGNRYDGIYKVVRYWPEKGKSGFLVWRFLLRRDD
VEPGPWTKEGKDRIKKLGLTMQYPEGYLEALAKKEKEKENKNSKRAAVEEEEEEGREDFE
TPRKGKRKSQAAGGGKVSDGPSRGAPKKTKVEPYSLTAQQSSLIKEDKSNTKLWTEILKS
LKDGPVSSPPGLKFLSKVEETFQCICCQELVFRPITTVCQHNVCKDCLDRSFKAQVFSCP
ACRYNLGRHSTMQVNQPLQAVLSQLFPGYGNGR
Download sequence
Identical sequences ENSSSCP00000014364 ENSSSCP00000014364

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]