SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000014479 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000014479
Domain Number 1 Region: 60-515
Classification Level Classification E-value
Superfamily Ras GEF 7.06e-101
Family Ras GEF 0.00017
Further Details:      
 
Domain Number 2 Region: 611-678
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.07e-23
Family Ras-binding domain, RBD 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000014479   Gene: ENSSSCG00000013625   Transcript: ENSSSCT00000014880
Sequence length 678
Comment pep:known_by_projection chromosome:Sscrofa10.2:2:70359228:70372384:1 gene:ENSSSCG00000013625 transcript:ENSSSCT00000014880 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERTAGKELALAPLQDWGEETEDGAVYSVSLRRQRSQRLSLGAGPGGTQTSSPAADTFLH
YRTSKVRALRAARLERLVRELVSGDREQDPGFVPAFLATHRAFVPTARVLGLLLPPPPPP
LPSGVELKKTEGRDLSLNKNLRAVVSVLGSWLRDHPQDFQDPPAHSDLGSVCTFLSWAAP
SGAEAQEAEKLLGDFLEEAEQEQEEEEQSQPWGGSLGAAQIPCPDSPAGCLEEEERLVRE
GPELLDFSVDEVAEQLTLMDVELFSRVRPCECLGSVWSQRDRPGATGTAPTVRATVTQFN
RVIGCVLGSVLGEPGLAAPQRAQRLEKWIRIAQRCRELRNFSSLRAILSALQSNPIYRLK
RSWGAVSREPLSTFRKLSQIFSDENNHLSSREILSQDEATKASQEEDTPPGSLLSKLPPG
PVPYLGTFLTDLVMLDTALPDILEGDLINFEKRRKEWEILARIQQLQRRCQSYCLSPRLP
VLAALRAQCQLSEEQSYRISRVIEPPAASCPSSPRVRRRISLTKRLSAKLSRERGSSPGG
SPGDPSFSTSRLCISPSVSPRSPPSSPITRDPPAGSPPASPGPQGPSIKLPLSPDLPGPR
PLALPLSGPRIPLPGQQGSEARVIRISINNDHGNLYRSILLTSQDKAPSVVQRALEKHNV
AQPWARDYQLFQVLPGDR
Download sequence
Identical sequences ENSSSCP00000014479 ENSSSCP00000014479

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]