SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000017125 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000017125
Domain Number 1 Region: 103-173
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000115
Family VWC domain 0.0065
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000017125
Domain Number - Region: 51-111
Classification Level Classification E-value
Superfamily FnI-like domain 0.00136
Family Fibronectin type I module 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000017125   Gene: ENSSSCG00000016168   Transcript: ENSSSCT00000017603
Sequence length 174
Comment pep:known_by_projection chromosome:Sscrofa10.2:15:129321537:129345591:1 gene:ENSSSCG00000016168 transcript:ENSSSCT00000017603 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALHIHEACILLLVIPGLVTSAAISHEDYPADEGDQTSNNDNLIFDDYRGKGCVDDSGFV
YKLGERFFPGHSNCPCVCALDGPVCDQPECPKIHPKCTKVEHNGCCPECKEVKNFCEYHG
KNYKILEEFKPSPCEWCRCEPSNEVHCVVADCAVPECVNPVYEPEQCCPVCKNG
Download sequence
Identical sequences ENSSSCP00000017125 ENSSSCP00000017125

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]