SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000017707 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000017707
Domain Number 1 Region: 333-470
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.01e-42
Family Nucleotide and nucleoside kinases 0.0000568
Further Details:      
 
Domain Number 2 Region: 193-323
Classification Level Classification E-value
Superfamily SH3-domain 9.32e-36
Family SH3-domain 0.0011
Further Details:      
 
Domain Number 3 Region: 122-212
Classification Level Classification E-value
Superfamily PDZ domain-like 6.97e-17
Family PDZ domain 0.00056
Further Details:      
 
Domain Number 4 Region: 54-108
Classification Level Classification E-value
Superfamily L27 domain 0.0000000000000765
Family L27 domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000017707   Gene: ENSSSCG00000016717   Transcript: ENSSSCT00000018198
Sequence length 484
Comment pep:known_by_projection chromosome:Sscrofa10.2:18:52549880:52661454:-1 gene:ENSSSCG00000016717 transcript:ENSSSCT00000018198 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQQVLDNLTELPSSTGAEEIDLIFLKGIMENPIVKSLAKAHERLEDSKLEAVSDNNLELV
NEILEDITPLINVDENVAELVGILKEPHFQSLLEAHDIVASKCYESPPSSPEMNNSSVNN
QLLPVDAIRILGIHKRAGEPLGVTFRVENNDLVIARILHGGMIDRQGLLHVGDIIKEVNG
HEVGNNPKELQELLKNISGSVTLKILPSYRDTITPQQVFVKCHFDYNPYNDNLIPCKEAG
LKFSKGEILQIVNREDPNWWQASHVKEGGSAGLIPSQFLEEKRKAFVRRDWDNSGPFCGT
ISSKKKKKMMYLTTRNAEFDRHEIQIYEEVAKMPPFQRKTLVLIGAQGVGRRSLKNRFIV
LNPTRFGTTVPFTSRKPREDEKDGQAYKFVSRSEMEADIKAGKYLEHGEYEGNLYGTKID
SILEVVQTGRTCILDVNPQALKVLRTSEFMPYVVFIAAPELETLRAMHKAVVDAGITTKL
LTVS
Download sequence
Identical sequences ENSSSCP00000017707 ENSSSCP00000017707

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]