SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000018407 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000018407
Domain Number 1 Region: 385-583
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.45e-48
Family Nucleotide and nucleoside kinases 0.00011
Further Details:      
 
Domain Number 2 Region: 202-305
Classification Level Classification E-value
Superfamily SH3-domain 1.6e-23
Family SH3-domain 0.0011
Further Details:      
 
Domain Number 3 Region: 134-217
Classification Level Classification E-value
Superfamily PDZ domain-like 5.52e-20
Family PDZ domain 0.0011
Further Details:      
 
Domain Number 4 Region: 67-118
Classification Level Classification E-value
Superfamily L27 domain 0.0000000000000204
Family L27 domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000018407   Gene: ENSSSCG00000017372   Transcript: ENSSSCT00000018911
Sequence length 587
Comment pep:known_by_projection chromosome:Sscrofa10.2:12:19531128:19556249:1 gene:ENSSSCG00000017372 transcript:ENSSSCT00000018911 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVLSEDSGLHETLALLTSQLRPDSNHKEEMGFLRDVFSEKSLSYLMKIHEKLRYYERQS
PTPVLHSAVALAEDVMEELQAASVHSDERELLQLLSTPHLRAMLMVHDTVAQKNFDPVLP
PLPDHIAEDFDEESVKIVRLVKNKEPLGATIRRDEHSGAVVVARIMRGGAADRSGLVHVG
DELREVNGVTVLHKRPDEISQILAQSQGSITLKIIPATQEEDRLKDSKVFMRALFHYDPR
EDRAIPCQEAGLPFQRRQVLEVVSQDDPTWWQAKRVGDTNLRAGLIPSKQFQERRLSYWR
ATGTLPSPQSLKKPPYDQPCDKETCDCEGYFKGHYVAQAGLRRSFRLGRRERLGSPQEGK
MSSVAEPLELPTYEEVTRYQHQPGERPRLVVLIGSLGARLHELKQKVVAENPQHFGVAVP
HTTRPRKSHEKEGVEYHFISKQAFEADLHHNKFLEHGEYKENLYGTSLEAIQVVMAKNKV
CLVDVEPDALQHLRTSEFKPYVIFVKPAIQEKRKTPPTSPACEDAAAPLDAEQQEMAASA
AFIDQHYGHWVDAVLVKEDLQTAHSQLRALLEKLSKDTHWVPISWVR
Download sequence
Identical sequences ENSSSCP00000018407 ENSSSCP00000018407 9823.ENSSSCP00000018407

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]