SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000020148 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000020148
Domain Number 1 Region: 282-465,602-747
Classification Level Classification E-value
Superfamily Ras GEF 2.35e-66
Family Ras GEF 0.0021
Further Details:      
 
Domain Number 2 Region: 488-588
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.37e-27
Family Ras-binding domain, RBD 0.0079
Further Details:      
 
Domain Number 3 Region: 205-284
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.0000000000000209
Family cAMP-binding domain 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000020148   Gene: ENSSSCG00000023526   Transcript: ENSSSCT00000028695
Sequence length 747
Comment pep:known_by_projection scaffold:Sscrofa10.2:GL893496.1:287:18625:-1 gene:ENSSSCG00000023526 transcript:ENSSSCT00000028695 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SQVGWPGESRWQVGLAVEDGSALGAPTVGGLPDVVPEGTLLHRPRSCSYQLLLEHQRPSR
IQGLRWTPLTNSEESLDFSVSLEQASTERVLRAGKQLHRHLLPSPGWVPGAGQSWGAGIR
WAXQDRDTQFYRFPGLEPEPAGVHELEEELVEALTLLSQRGPDALLTVALRKPPGQRTDE
ELDLLGPNLLPAQLAPLPLDSPHHLLSLVLLFEPHSKAGTVLFSQGDKGTSWYIIWKGSV
NVVTHGKGLVTTLHEGDDFGQXEDNCHFLRVDKQDFNRIIKDVEAKTMRLEEHGKVVLVL
ERSSQGSGPSRPPTPGRNRYTVMSGTPEKILELLLEAMRPDSSAHDPTETFLSDFLLTHS
VFMPNAQLCAALLHHFHAEPAGGSEQECSTYVCNRRQQILRLVSQWVALYGPMLHTDPVA
TSFLQKLSDLVSKDARLSNLLREQWPERRRHHRSPGGGGRRLPFSPLQARHMPVWLPSQD
EPLPSSNCAIRAGDKVPYDICRPDHSVGTLQLPVTASVREVMAALAQEDGWTKGQVLVKV
NSAGDAVGLQPDARGVATSLGLNERLFVVNPQEVHELTPHPEQLGPTVSSAEGLDLVSTK
DVQGQSAGEESGWQGLPPWHVLASHAARSQVELIQRRFNELQYWVATELCLCSVPSLRAQ
LLRKFIKLAAHLKEQKNLNSFFAVMFGLSNSAISRLAHTWERLPHKVRKLYSALERLLDP
SWNHRVYRVALTKLSPPVIPFMPLLLK
Download sequence
Identical sequences ENSSSCP00000020148 ENSSSCP00000020148

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]