SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000020362 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000020362
Domain Number 1 Region: 197-262
Classification Level Classification E-value
Superfamily Second domain of FERM 5.63e-17
Family Second domain of FERM 0.0000237
Further Details:      
 
Domain Number 2 Region: 81-137
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000285
Family First domain of FERM 0.097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000020362   Gene: ENSSSCG00000025668   Transcript: ENSSSCT00000022839
Sequence length 263
Comment pep:known chromosome:Sscrofa10.2:1:120624099:120633359:-1 gene:ENSSSCG00000025668 transcript:ENSSSCT00000022839 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVALSLKICVRHCNVVKTMQFEPSTAVYDACRVIRERVPEAQTGQASDYGLFLSDEDPRK
GIWLEAGRTLDYYMLRNGDILEYKKKQRPQKIRMLDGSVKTVMVDDSKTVGELLVTICSR
IGITNYEEYSLIQETIEEKKEEGTGTLKKDRTLLRDERKMEKLKAKLHTDDDLNWLDHSR
TFREQGVDENETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFEKACEF
GGFQAQIQFGPHVEHKHKPGFLE
Download sequence
Identical sequences M3Z9X6
XP_020752470.1.74333 XP_020752471.1.74333 XP_020752472.1.74333 XP_020752473.1.74333 XP_020752474.1.74333 XP_020752475.1.74333 ENSSSCP00000020362 ENSSSCP00000020362

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]