SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000020787 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000020787
Domain Number 1 Region: 57-156
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.03e-40
Family First domain of FERM 0.00000275
Further Details:      
 
Domain Number 2 Region: 158-224
Classification Level Classification E-value
Superfamily Second domain of FERM 5.76e-18
Family Second domain of FERM 0.000021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000020787   Gene: ENSSSCG00000030641   Transcript: ENSSSCT00000029480
Sequence length 224
Comment pep:known_by_projection scaffold:Sscrofa10.2:GL895718.2:7605:70694:-1 gene:ENSSSCG00000030641 transcript:ENSSSCT00000029480 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKSRCSPFPVCWAKEYDRYLASSKIMAAAYLDPNLNHTPNSSTKTHLGTGVERSPGAMD
RVLKVFHYFESNSEPTTWASIIRHGDATDVRGIIQKIVDSHKVKHVACYGFRLSHLRSEE
VHWLHLDMGVSSVREKYELAHPPEEWKYELRIRYLPKGFLNQFTEDKPTLNFFYQQVKSD
YMLEIADQVDQDIALKLGCLEIRRSYWEMRGNALEKKSNYEVLE
Download sequence
Identical sequences ENSSSCP00000020787 ENSSSCP00000020787

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]