SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000020831 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000020831
Domain Number 1 Region: 5-235
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 1.63e-45
Family Galactose oxidase, central domain 0.0052
Further Details:      
 
Domain Number 2 Region: 266-341
Classification Level Classification E-value
Superfamily Kelch motif 0.00000000000000116
Family Kelch motif 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000020831   Gene: ENSSSCG00000023441   Transcript: ENSSSCT00000031589
Sequence length 350
Comment pep:known_by_projection chromosome:Sscrofa10.2:9:72239600:72247893:-1 gene:ENSSSCG00000023441 transcript:ENSSSCT00000031589 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVPNVKDFQWKRLAPLPSRRVYCSLLETGGQVYAIGGCDDNGVPMDCFEVYSPEADQWT
ALPPLPTARAGVAVTALGKRIMVIGGVGTSQLPLKVVEMYNIDEGKWKKRSMLREAAMGI
SVTAKDYRVYAAGGMGLDLRPHNHLQHYDMLKDMWVSLAPMPTPRYAATSFLRGSKIYVL
GGRQSKYAVNAFEVFDIETRSWTKFPNIPCKRAFSSFVTLDDRLYSLGGLRQGRLYRQPK
FLRTMDVFDMEQGGWLKMERSFFLKKRRADFVAGSVSGRVIVAGGLGNQPTVLETAEAFH
PGKNKWEVLPAMPTPRCACSSIVIKNCLLAVGGVNQGLSDAVEALCVSDS
Download sequence
Identical sequences I3L9W7
ENSSSCP00000020831 ENSSSCP00000020831 XP_003357440.1.46622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]