SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000021603 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000021603
Domain Number 1 Region: 415-618
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.97e-59
Family Nucleotide and nucleoside kinases 0.0001
Further Details:      
 
Domain Number 2 Region: 217-330
Classification Level Classification E-value
Superfamily SH3-domain 8.79e-29
Family SH3-domain 0.0011
Further Details:      
 
Domain Number 3 Region: 127-230
Classification Level Classification E-value
Superfamily PDZ domain-like 1.18e-19
Family PDZ domain 0.0016
Further Details:      
 
Domain Number 4 Region: 84-134
Classification Level Classification E-value
Superfamily L27 domain 0.0000000000000275
Family L27 domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000021603   Gene: ENSSSCG00000026184   Transcript: ENSSSCT00000032532
Sequence length 628
Comment pep:known_by_projection scaffold:Sscrofa10.2:GL892407.1:37862:78080:-1 gene:ENSSSCG00000026184 transcript:ENSSSCT00000032532 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIQSDKGADPLSKKDQKDKKLSTATNPESGISQILRLVLFYSRDVNGVCLLYDLLHCPWL
QALLKVYDSLQDFKEKQLIPATPHAQALSNEVLKILCETPKSPEIQELRQILQSPHFKAL
LSAHDTVAQKDFEPLLPPLPDNIPESEEAMRIVCLVKNQQPLGATIKRHEMTGDILVARV
IHGGLVERSGLLYAGDKLVEVNGISVEGLDPEQVIHILAMSRGTIMFKVVPVLDPPVNSH
KMVYVRAMTEYWPQEDPAIPCMDAGLPFQKGDILQIVDQNDALWWQARKISDLGTCAGLI
PSNHLLKRKQREFWWSQPYQPHNHLKSAISISMEEEDDMKIDEKCVEAEELSEDKEEFVG
CGQKFYIAGFRRSMRLCRRKSHLSQLRAKVSGASNCYGAVGAPYEEVVRYQRHPANKHRL
IVLLGPSGVGVNELRRQLIELNPNRFQSAVPHTTRSKKSYEMDGREYHYVSKETFESLMY
SHRMLEYGEYKGHLYGTSVDAVQAVLDEGKICVMDLEPQGIQVARTQELKPYVIFIKPSS
MSCMKRSRKNAKIITDYFVDMKFKEEDLQEMEDLAQKMESQFGQFFDHVIVNDNLQDACA
QLLSAVQKAQEEPQWVPATWVSSDKELE
Download sequence
Identical sequences ENSSSCP00000021603

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]