SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000024296 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000024296
Domain Number 1 Region: 48-143
Classification Level Classification E-value
Superfamily NSFL1 (p97 ATPase) cofactor p47, SEP domain 2.49e-29
Family NSFL1 (p97 ATPase) cofactor p47, SEP domain 0.00022
Further Details:      
 
Domain Number 2 Region: 127-240
Classification Level Classification E-value
Superfamily Ubiquitin-like 6.21e-24
Family UBX domain 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000024296   Gene: ENSSSCG00000026283   Transcript: ENSSSCT00000029299
Sequence length 252
Comment pep:known_by_projection chromosome:Sscrofa10.2:3:121943291:121959525:-1 gene:ENSSSCG00000026283 transcript:ENSSSCT00000029299 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LKYAKEQKVCETGSDHQPLSDNQQINCEYFVDSLFEEAQKVGAKSLSPTEQKKQVDVSIK
LWKNGFTVNDDFRSYSDGASQQFLNSIKKGELPLELQGVFDKEEVDVRVEDKKNEVCMST
KPVFQPFSGQGHRLGSATPKIVSKAKSIEVENKNKLSTVPLNNLEPITNVQIWLANGKRI
VQKFNISHRISHIKDFIEKYQGPQRSPPFSLATALPFLKLLDETLTLEEADLQNAVIIQR
LKKTAEPFKELS
Download sequence
Identical sequences ENSSSCP00000024296

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]