SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000026679 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000026679
Domain Number 1 Region: 33-189,324-378,477-511
Classification Level Classification E-value
Superfamily WD40 repeat-like 9.16e-22
Family WD40-repeat 0.01
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000026679
Domain Number - Region: 477-599
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.0502
Family Quinoprotein alcohol dehydrogenase-like 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000026679   Gene: ENSSSCG00000029205   Transcript: ENSSSCT00000025261
Sequence length 1203
Comment pep:known scaffold:Sscrofa10.2:JH118980.1:18886:54708:1 gene:ENSSSCG00000029205 transcript:ENSSSCT00000025261 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPYTVNFKVSARTLTGALNAHNKAAVDWGWQGLIAYGCHSLVVVIDSNTAQTLQVLEKH
KADVVKVKWARENYHHNIGSPYSLRLASADVNGKIIVWDVAAGIAQCEIQEHAKPIQDVQ
WLWNQDASRDLLLAIHPPNYIVLWNADTGTKLWKKSYADNILSFSFDPFDPSHLTLLTSE
GIVFISDFSPSKPPSGPGKKVYISSPHSSPAHSKVAAATXKILITQEKPSAEFITLNDCL
QLAYLPSKRNHMLLLYPREILILDLEVNQTVGVIAIERTGVPFLQVIPCFQRDCLFCLHE
NGCITLRVRRSYNSIFTTSSEEPDPDPVQELTYDLRSQCDAIRVTKTVRPFSMVCCPVNE
NAAALIVSDGRVMIWELKSAVCSRNSRNSSSGVSPLYSPVSFCGIPVGVLQNKLPDLSLD
NMIGQSAVAGEEHPKSPILQEVHLKFLLTGLLSGLPSPHFAIRMCPPLTTKNIKVYQPLL
AVGTSNGSVLVYHLTSGLLHKELSIHSCEVNDKILEITLXTGFLSFATSTPNNMGLVRNE
LQLVDLPTDVAIYKTCSKGSVVTALERVHHCMQIVLTQVQGKMEHPWPERTGTLLWITRN
TVLNFWSLQETLKILKNKDLICLCIMVYLKILTSSLCYIIVLLVTEESTLCMYHIFFISR
KYSSKVICSELLKTYNPMSFKITWKWNKVKILYYFLYSVWILTHKLYLCVINHAYSYFLI
FSVFISSLQLFLPTYQSMLLNFKELAPIFVQCYSSLLGSDLPTDLCVHIPDLPTDWHWSP
SYVAQRHMGQEIVNTCSKSVCPTGEYWETWECLYYFGYLLLLRASSFYGRQLLYRRCIKT
LEKNIFVFRLLETEQEKKGLQLQAGALLFVVNEFILCPVFNQIVLLLLNGMFWLDPTPVF
CRWLRVLRGGSEDVAASTTAARAPAPRDRVNNPLDICYDILCENAYFQKFQLERVNLQEV
KRSTYDHTRKCTDQLLLLGQTDRAVQLLLETSAENQHYYCDSLKACLVTTVTSSGPSQST
IKLVATNMIANGKLAEGVQLLCLIDKAADACRYLQTYGEWNRAAWLAKVGHPRSALNTWD
RKFRLDSVGASDRSIAPLQPGVALPGTGRGAGFSRAALLGALSPSWASFSPAHESLAEGA
LFALVFLNWASQKLIAAIYADYARSLKNLGFKQGAVLFASKAGAAGRDLLNELESPKQEL
TAQ
Download sequence
Identical sequences ENSSSCP00000023883 ENSSSCP00000026679

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]