SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000027815 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000027815
Domain Number 1 Region: 407-550
Classification Level Classification E-value
Superfamily PH domain-like 1.88e-40
Family Third domain of FERM 0.0000101
Further Details:      
 
Domain Number 2 Region: 303-408
Classification Level Classification E-value
Superfamily Second domain of FERM 7.07e-35
Family Second domain of FERM 0.00000535
Further Details:      
 
Domain Number 3 Region: 223-302
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.25e-26
Family First domain of FERM 0.0000856
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000027815   Gene: ENSSSCG00000030092   Transcript: ENSSSCT00000024281
Sequence length 557
Comment pep:novel scaffold:Sscrofa10.2:GL894578.1:28364:138305:1 gene:ENSSSCG00000030092 transcript:ENSSSCT00000024281 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AVTMTTEVGSASEVKKESDQLGADATKEKPKEVAENQQNQSSDPEEEKGSQSSPPAESQS
SSRPQKKERDPSGSRGISRFIPPWLKKQKSYTLVVAKDGGDKKEPTQAVVEEQILAKEES
LPEEGKQAKGDAAEMALQKQQQIKVDVKEEKPPVSSLEMQALSQIIVPPVEEVSKEREEE
KGKEIQEDTLDEAAKRETKEVQTNELKAEKASQKATKKTKTVQCKVTLLDGTEYSCDLEK
RAKGQVLFDKVCEHLNLLEKDYFGLVFQENPEQKNWVDPAKEIKRQLRNLPWLFTFNVKF
YPPDPSQLTEDITRYFLCLQLRQDIASGRLPCSLMTHALLGSYTLQAELGDYDPEEHDSN
DLSDFQFAPTQTKELEEKVAELYKTHRGLSPAQADSQFLENAKRLSMYGVDLHHAKDSEG
VDIKLGVCANGLLIYKDRLRINRFAWPKILKISYKRSNFYIKVRPAELEQFESTIGFKLP
NHRAAKRLWKVCVEHHTFYRLVSPEPPPKAKFLTLGSKFRYSGRTQAQTRQASTLIDRPA
PHFERTSSKRVSRSLDG
Download sequence
Identical sequences ENSSSCP00000027815 ENSSSCP00000027815

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]