SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000028508 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000028508
Domain Number 1 Region: 907-1198
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 5.06e-87
Family Complement components 0.0000158
Further Details:      
 
Domain Number 2 Region: 1279-1407
Classification Level Classification E-value
Superfamily Alpha-macroglobulin receptor domain 7.06e-30
Family Alpha-macroglobulin receptor domain 0.0018
Further Details:      
 
Domain Number 3 Region: 742-794
Classification Level Classification E-value
Superfamily E set domains 0.00000000392
Family SVA-like 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000028508   Gene: ENSSSCG00000004485   Transcript: ENSSSCT00000035901
Sequence length 1449
Comment pep:known_by_projection chromosome:Sscrofa10.2:1:103132170:103292068:-1 gene:ENSSSCG00000004485 transcript:ENSSSCT00000035901 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLGPLLVTAAHLVCMWSSVLAAAPGPRFLVTAPGIIRPGGNVTIGVELLEHSPSQVTVKA
ELVKMAANLTVSVLEAEGVFEKGSFKTLILPSLPLNSADEMYELRVTGHAQNEVLFSNST
RLSFETKRTTVFIQTDKPLYKPKQEVKFRIITLFSDFKPYKTSLNILIKDPKSNLIQQWL
SEQSDLGVVSKTFQLSSHPILGDWSIQVQVNDQTYYQSFQVSEYVLPKFEVALQTPLYCS
LNSKSLNGTVTAKYTYGKPVKGDVTLTFLPLSFWGVKKNITKTFKINGSANFSFNDEEMK
KVMDFSDRPSEHMYLSSPGPVEILATVTESLTGISRNASSNVFFKQHNYIIEFFDYATVL
KPSLNFTATVKVTRSDGSQLTPEERRNNVVITVTQKNYTKSWSRWDSMDQEAGPIQVINH
TVPDNGVFKIEFPILADSSELQLKAFFLDSVSSMAVHGMFKSPSKTYIQLKTRDENIKVG
LPFELVVIGNKQLKELSYMVVSRGQLVAVGKQNSSTFSLTPENSWAPKACIIVYYIEDDG
EIINDVLKIPVQLVFKNKIQLFWSKANAEPSEKVSLRVSVTQPDSVVGIVAVDKSLNLMN
ISNDITMENVVHELELYNTGYYLGMFMNSFAVFQECGLWVLTDANLVKDFIDGVYDSVEW
AERFVEENEGHLVDFHDFSLGSSPRVRKHFPETWIWLDTKMGSRIYQEFEVTVPDSITSW
VATAFVISEDLGFGLTPAPVELQAFQPFFIFLNLPYSVIRGEEFALEVTIFNYLKDATEV
KIIVEKSDEFDILMASNEINATGHQQTVLVPSADGATVLFPVRPTCLGEVLITVTAISPA
ASDALTQRILVKAEGIEKSYSQSILLDLTDRKLQTTQKTLSFSFPPDTVSGSERVQVTAI
GDILGSSINGLASLIRMPYGCGEQNMINFAPNIYVLDYLTKKKQLTENLKEKALSFMRQG
YQRELLYQREDGSFSAFGNDDPSGSTWLSAFVLRCFLEADPYIDIDQNVLHRTYTWLKGH
QKSNGEFWEPGRVIHSELQGGNQSPITLTAYIVTSLLGYKKYQPNIDVQESINFLESEFD
KGISDNYTLALVTYALSSVRSPKAKEALNVLTSGAEQEGGMQFWVSAVSRLSESWQPSSL
DIEVAAYTLLAHFLQNQVSEGIPIMRWLSRQRNSLGGFASTQDTVVALKALSEFAALMNT
EKTDIQVKVVGPRSSSPVKFLINTENRFLLQTAELAVEEPTAVNISASGFGFAICQLNVI
YNVKDSRSSRIRKSIQDQEAFDLDIAVKDNNDDVNHLNLSVCTRFLGPARSGMALMEVNL
LSGFTVPSDSLPLSETLKKVEYDVGKLNLYLDSVNETQFCVDIPAVRNFRVSNTQDASVS
IVDYYEPRRRAARSYNSRAKLSSCDLCGDMNACGGCDRTVSASPPHLAISLLCCFILLFS
LLFWLGFAF
Download sequence
Identical sequences K7GKY0
ENSSSCP00000028508 XP_001927580.3.46622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]