SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000028868 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000028868
Domain Number 1 Region: 124-173
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 0.0000000000252
Family 2Fe-2S ferredoxin-related 0.0061
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000028868
Domain Number - Region: 69-102
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 0.0252
Family 2Fe-2S ferredoxin-related 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000028868   Gene: ENSSSCG00000013651   Transcript: ENSSSCT00000036161
Sequence length 177
Comment pep:known_by_projection chromosome:Sscrofa10.2:2:69459510:69463860:-1 gene:ENSSSCG00000013651 transcript:ENSSSCT00000036161 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XAASVAWGGVNAGFLLRAARGAWWSRPGGILGSGEAAAPAIARKFRATGSRPAGEEEAGG
PERLGDVVNVVFVDRSGQRIPVSGRVGDNVLHLAQRHGVDLEGTQPGAQPAAESWGDGTP
RTCLCKTHKQVGNSQLRACEASLACSTCHVYVSEDHLDLLPPPEEREDDMLDMAPLL
Download sequence
Identical sequences ENSSSCP00000028868

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]