SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000029464 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000029464
Domain Number 1 Region: 35-136
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 0.0000000000000151
Family Eukaryotic proteases 0.004
Further Details:      
 
Domain Number 2 Region: 2-49
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000105
Family Complement control module/SCR domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000029464   Gene: ENSSSCG00000002749   Transcript: ENSSSCT00000034467
Sequence length 137
Comment pep:novel chromosome:Sscrofa10.2:6:14643497:14647600:1 gene:ENSSSCG00000002749 transcript:ENSSSCT00000034467 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVRYHCQTYYKLRTAGDGVYTLDSNKQWTNKVTGEKLPECEAVCGKPKNPVDQVQRIMGG
SLDAKGSFPWQAKMISHHNLTSGATLINEQWLLTTAKNLRLGHKNDTKAKDIAPTLRLYV
GKKQEVEIEKVIFHPDN
Download sequence
Identical sequences ENSSSCP00000029464

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]