SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000029512 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000029512
Domain Number 1 Region: 404-794
Classification Level Classification E-value
Superfamily Ankyrin repeat 7.79e-133
Family Ankyrin repeat 0.000000000174
Further Details:      
 
Domain Number 2 Region: 166-419
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.77e-73
Family Ankyrin repeat 0.00000273
Further Details:      
 
Domain Number 3 Region: 17-232
Classification Level Classification E-value
Superfamily Ankyrin repeat 6.58e-55
Family Ankyrin repeat 0.0000131
Further Details:      
 
Domain Number 4 Region: 4052-4162
Classification Level Classification E-value
Superfamily DEATH domain 1.24e-25
Family DEATH domain, DD 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000029512   Gene: ENSSSCG00000010212   Transcript: ENSSSCT00000034950
Sequence length 4346
Comment pep:known_by_projection chromosome:Sscrofa10.2:14:68392395:68680043:-1 gene:ENSSSCG00000010212 transcript:ENSSSCT00000034950 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDKIPAKRSDANASYLRAARAGHLEKALDYIKNGVDINICNQNGLNALHLASKEGHVEVV
SELLQREASVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQE
NHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAA
RKDDTKAAALLLQNDNNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDIT
PLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSK
TKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKK
ANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVS
QLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLG
KADIVQQLLQQGASPNAATTSGYTPLHLSAREGHEDVAAFLLDHGASLSITTKKGFTPLH
VAAKYGKLEVANLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKN
GYTPLHIAAKKNQMDIATTLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANV
NLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLL
QHSAKVNAKTKNGYTPLHQAAQQGHTHIINVLLQNDASPNELTVNGNTALAIARRLGYIS
VVDTLKVVTEETMTTTTIIEKHKMNVPETMNEVLDMSDDEVRKANAPEMLSDGEYISDVE
EGEDAVTGDTDKYLGPQDLKELGDDSLPAEGYVGFSLGARSASLRSFSSDRSYTLNRSSY
ARDSMMIEELLVPSKEQHLTFTREFDSDSLRHYSWAADTLDNVNLVSSPVHSGFLVSFMV
DARGGSMRGSRHHGMRIIIPPRKCTAPTRITCRLVKRHKLANPPPMVEGEGLASRLVEMG
PAGAQFLGPVIVEIPHFGSMRGKERELIVLRSENGETWKEHQFDSKNEDLTELLNGMDEE
LDSPEELGKKRICRIITKDFPQYFAVVSRIKQESNQIGPEGGILSSTTVPLVQASFPEGA
LTKRIRVGLQAQPVPDEIVKKILGNKATFSPIVTVEPRRRKFHKPITMTIPVPPPSGEGA
SNGYKGDTTPNLRLLCSITGGTSPAQWEDITGTTPLTFIKDCVSFTTNVSARFWLADCHQ
VLETVGLATQLYRELICVPYMAKFVVFAKMNDPVESSLRCFCMTDDKVDKTLEQQENFEE
VARSKDIEVLEGKPIYVDCYGNLAPLTKGGQQLVFNFYAFKENRLPFSIKIRDTSQEPCG
RLSFLKEPKTTKGLPQTAVCNLNITLPAHKKETESDPDDEMEKTERRQTFASLALRKRYS
YLTEPGMIERSAGATRSLPTTYSYKPFFSTRPYQSWTTAPITVPGPAKSGFTSLSSSSSN
TPSASPLKSIWSVSTPSPIKSTLGASTTSSVKSISDVASPIRSFRTISSPIKTVVSQSPY
NIQVSSGTLVRAPTVTEASPLKGLASNSTFSPRTSPVTTAGSLLERSSITMTPPASPKSN
INMYSSSLPFKSIITSAAPLISSPLKSVVSSAKPTVDVVSAAKVTMASSLSSPVKQMPGP
AEVVLVNGSISPLKYPSSSTLMNGCKATATFQEKISTATNSVSSVLNAASDTVEKAYPVT
TAMPFSPLRSFVSPAPSAFQALRTPSASALYTSLGSSLSATTSSVTSSVITVPVYSVVSV
LPEPAFKKLPDSNSLTKSAAALLSPVKTLATETRPQPHFPRTASPVKSSLFLAPSALKLS
TPSSLSSSQEILKDVAEMKEDLMRMTAILQTDVPEEKPFQPELPKEGRIDDEEPFKIVEK
VKEDLVKVSEILKKDVCVEDKGPPKSPKSDKGHSPEDDWIEFSSEEIREARQQAPTSPAP
SLPERVQVKAKAASEKDYNLTKVIDYLTNDIGSSSLTNLKYKFEDVKKDGEERQKRILKP
AIALQEHKLKMPPASMRPSTSEKELCKMADSFFGTDTILESPDDFSQHDQDKSPLSDSGF
ETRSEKTPSAPQSAESTGPKPLFHDVPIPPVITETRTEVVHVIRSYEPSAGDAPPSQPEE
PVSPKPSPPFMELEPKPTPSTIKEKVKAFQIKASGEEDEHGRVLGKGMRVKEETHITTTT
RMVYHSPPGSEGASERIEETMSVHDIMKAFQSGRDPSKELAGLFEHKSTVSPDAHRSAAE
TSAQHAEKDHQMKPKLERIIEVHIEKGNQAEPTEVIIRETKKHPEKEMYVYQKDLSRADI
NLKDFLPEKHDAFPCPEEQGQQEEEELTAEESLPSYLESSRVNTPVSQEEDSRPSSAQLI
SDDSYKTLKLLSQHSIEYHDDELSELRGESYRFAEKMLLSEKLDVSQSDTEESVTDHAGP
PSSELQGSDKRPREKVVTAPPKEILSKVYKDVSENGVGKVSKDEHFDKVAVLHYPADVSG
PKQAMWMRLAEDRLERGREKLIYEDRVDRTVKEAEEKLTEVSQFFRDKTEKLNDELQSPE
KKPRPRNGKEYSSQSPPGSSPEKALLASSEEWVKARQPGRDGEGCPKADERNAASPPSSP
ETVLSQQTEDSKATEEAKASISQSKEPEGPPSGFQLKQSKLSSIRLKFEQGAQAKSKDVS
QEDKKPEGQSRIPVKKIQESKLPVYQVFAREKPQKASDESGSAPKDLMVLKAKDEHAQSN
EIVVNDSGSDDVKKQRPEMSSKVMPDSFSEQQAKDLACHVTSDVATKGPWDQKVFRTWES
SGAPNNKPQKEKLSHVLVHDVRENHAGHPESKIVDQRDAFLSVTEREHTLLTNGSLSEIK
EMTVKSPSKKVLYREYVVKEGERPGGSLDQPPRRSDSSAVSHIPVRVAGERTTPTSNIPD
GFFEPPVFPKHELSPKLSQSRMSQETVETQHFNSIDKEKVTYSEISKVSKHQSYVGLCPP
FEETEVSPIKSPDSLEFSPGKESPSSDVFDRSPIDGLEKAAPLVQTEGGKEIRTLPVYVS
FVQVGKQYEKEIQQGGVKKIVSQECKTVQETRGAFYTTRQQKQPPSPQGSPEDDTLEQVS
FLDSSGKSPLTPETPSSEEVSYEFTSKTPDSLIAYIPGKPSPIPEVSEESEEEEPAKSAS
LKPTAAEGTAAIEREAPPDVSKDSSQRPKSNRVAYIEFPPPPPLDADPVESDRKHPHLPE
REVDLIEVSLQDEHDKDQLAEPVIRVQPPSPVPPGADVSDSSDDESLYQPVPVKKYTFKL
KDVDDEQKERTPPKTSTGKGSDQKALVEVNGSGKEHDFGLGLDSPQNETAQNGNNDQSIT
ECSIATTAEFSHDTDATEIDSLDGYDLQDEDDGLTESDSKLPSQTLEVKKDIWNTEGILK
PADRSFSQSKLEVIEEEEGRVGPDEEKPPPRSSSSEKSSDKTDPKSGAQFFTLEGRHPDR
SVFPDTYFSYKVDEEFATPFKTVATKGLDFDPWSNNRGDDDVYDGKSREDESKPFGLAVE
DRSPATTPDTTPARTPTDESTPTSEPNPFPFHEGKMFEMTRSGAIDMSKRDFVEERLQFF
QIGEHTSEGKSGDQGEGDKSMVTATPQPQAGDTTVDTNVESNVEAPSVEPQPSILTSGEC
QEGTASSGSQEKAAAAANASKVDPKLRTPIKMGISASTMTMKKEGPGEVTDKIEAVMTSG
QGLENETITVISNTANSLTGVRPQDKHDFQRDNFNNNNNLDSATIQTDNITSHVVLTEHS
APTCTTKKANPVRSSPGKKTGVLQGHCVRDKQKVLGEQQKAKESIGIRRKSKLPIKATSP
KELLPPNHMPNINVSKMKQASQSEKTKTLTASSCVDVKSRIPVKDTHRDDTGSLRKPCAT
QKQGQPEKGRAKQLPSKLPVKVRSTCVTTTSTTPTTSTTPTTTTTTTTTTVKVRKSQLKE
VCKHSIEYFKGISGETLKLVDRLSEEDKKMQSEVSDEEDSTSRNTSLSETSRGGQPSVTT
KSARDKKTEAAPLKSKSEKAGSEKRSSRRTGPQSPCERTDIRMAIVADHLGLSWTELARE
LNFSVDEINQIRVENPNSLISQSFMLLKKWVTRDGKNATTDALTSVLTKINRIDIVTLLE
GPIFDYGNISGTRSFADENSVFHDPVDGWQNETSSGNLEPPAQARRITGGLLDRLDDSPD
QCRDSITSYLKGEPGKFEANGSHAEVTPEAKTKSYFPESQNDVGKQSAKETLKPKIPGPG
RVDEPSSSLAAYQKALEETSKFVIEEPKPCMPVSMKKMSRTSPTDGKPRLNLHEEEGSNG
SEQKQGEGYKVKTKKEIRHVEKKSHS
Download sequence
Identical sequences ENSSSCP00000029512

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]