SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000029958 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000029958
Domain Number 1 Region: 210-339
Classification Level Classification E-value
Superfamily TPR-like 2.09e-27
Family Tetratricopeptide repeat (TPR) 0.0048
Further Details:      
 
Domain Number 2 Region: 96-180
Classification Level Classification E-value
Superfamily FKBP-like 0.0000000293
Family FKBP immunophilin/proline isomerase 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000029958   Gene: ENSSSCG00000001431   Transcript: ENSSSCT00000034571
Sequence length 349
Comment pep:known chromosome:Sscrofa10.2:7:27993041:27994663:-1 gene:ENSSSCG00000001431 transcript:ENSSSCT00000034571 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METPPVSPLGEKNISQPQQRWKKNSQKILDSTTQIRQQPQDPSTELLEGRVSPDPAGQIL
ENLQEIEKLAVGREGDSDKSHGPASEMPEPLQASELWYCPDGSFVKKILIHGHGLDKPKL
GSRCRVQVLGFPLGSGLPEGWTELTMGLGPWREETWGELVEKCLESMCQGEEAELQLPGR
SGPPVRLKLASFTQGRDSWELEPTEKEALAREERARGTELFRAGNPEGAARCYGRALRLL
LTLPPPGSPERTVLHANLAACQLLLGQPHLAAQSCDRVLEREPGHLKALYRRGVAQAALG
NLDKATADLKKVLAVDPKNRAAQEELGKVIIQGKKQDAGLAQGLRKMFG
Download sequence
Identical sequences A5A8W3
ENSSSCP00000001534 ENSSSCP00000029958 9823.ENSSSCP00000001534 NP_001121957.1.46622 XP_005665882.1.46622 XP_013833108.1.46622 XP_020953701.1.46622 ENSSSCP00000001534

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]