SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SSCA000247-PA from Sarcoptes scabiei

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SSCA000247-PA
Domain Number 1 Region: 11-153
Classification Level Classification E-value
Superfamily PHP domain-like 3.53e-19
Family RNase P subunit p30 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SSCA000247-PA
Sequence length 154
Comment pep supercontig:SscaA1:JXLN01018310:20497:21234:-1 gene:SSCA000247 transcript:SSCA000247-RA gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLMNIPVPPRIKTIHSDLKILKRLTIRIDDGNSLFHLNKSETIKQYDLLALEPINERMLN
HLNAGRIDFDILTFNQSDSSLFNSIKKANFSLPISKGIAIELNYGHCLVSSTQRRQTLAF
GQILVDKTLGKNIILSSGTKSHLKIRSPRDVIYL
Download sequence
Identical sequences A0A132AM44
SSCA000247-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]