SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for SSCA003787-PA from Sarcoptes scabiei

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SSCA003787-PA
Domain Number 1 Region: 80-308
Classification Level Classification E-value
Superfamily 2,3-Bisphosphoglycerate-independent phosphoglycerate mutase, substrate-binding domain 7.85e-69
Family 2,3-Bisphosphoglycerate-independent phosphoglycerate mutase, substrate-binding domain 0.00000657
Further Details:      
 
Domain Number 2 Region: 7-80,308-512
Classification Level Classification E-value
Superfamily Alkaline phosphatase-like 7.73e-68
Family 2,3-Bisphosphoglycerate-independent phosphoglycerate mutase, catalytic domain 0.000011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SSCA003787-PA
Sequence length 513
Comment pep supercontig:SscaA1:JXLN01014003:4943:6600:-1 gene:SSCA003787 transcript:SSCA003787-RA gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSPENQVCLIVIDGWGISEIKQGNAIANAETPVMSGLAQNKDQYCTLDASGLSVGLPDG
LMGNSEVGHLNIGAGRVIYQDIVRINLDVERKAMRMNASFKEACERAKSYNGRLLFLGLI
SDGGVHAHIDHLFALLEAAKANQVPKSFIHFFSDGRDTSPTSGIEYIKKVLDKTKEINYG
SLSTIMGRYYAMDRDKRWERIRIAVDGLIDGIGEKTSSENVIDCVKNNYQNGVTDEFLKP
IIVDAEGLITENDTLVFINYRADRVRQITETLGLKQYFDPPKENLPRNIELFTMTEYKKE
FPFKQLYPSVVPKNVLAEVISKASWPQFHTAETEKYAHVTFFFNGGQEKAFEGEERVMVP
SPKVATYDLQPEMNCAGVAEEMAKAIASKRYPFLMCNFAPPDMVGHTGKYEPTVRACSAT
DKAIGVIKKACEENNYILLITADHGNAEKMFDDKGGPLTSHTTNRVPFCMYNTDFKFNLP
PDHNPALCDVAPTVLKLLGLTIPTEDMTGKILI
Download sequence
Identical sequences A0A132AH18
SSCA003787-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]