SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for SSCA002101-PA from Sarcoptes scabiei

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SSCA002101-PA
Domain Number 1 Region: 93-188
Classification Level Classification E-value
Superfamily PDZ domain-like 1.31e-28
Family PDZ domain 0.0081
Further Details:      
 
Domain Number 2 Region: 6-68
Classification Level Classification E-value
Superfamily L27 domain 0.00000000000000647
Family L27 domain 0.00083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SSCA002101-PA
Sequence length 201
Comment pep supercontig:SscaA1:JXLN01008337:9572:10438:1 gene:SSCA002101 transcript:SSCA002101-RA gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSEQLNLEHDIRRACELIDKLQKTEYNAWLSSNASLKKLATLKKIFESDFFNAVREVYE
RVYETVDITGSPDIRASATAKATIAVFAASEGHAHPRIVELPKTDEGLGFNVMGGREQNT
PIYISRIIPDSVADRHGGLKRGDQLISINGFNVENESHEKVVELLKSAIDKVTLVVRYTP
KVLEEMEMRFDKQRMRHRKFK
Download sequence
Identical sequences A0A132A193
SSCA002101-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]