SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Spoth1|59222|estExt_Genewise1.C_10482 from Sporotrichum thermophile ATCC 42464

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Spoth1|59222|estExt_Genewise1.C_10482
Domain Number 1 Region: 68-180
Classification Level Classification E-value
Superfamily FKBP-like 3.47e-31
Family FKBP immunophilin/proline isomerase 0.0000148
Further Details:      
 
Domain Number 2 Region: 4-39
Classification Level Classification E-value
Superfamily WW domain 0.0000000208
Family WW domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Spoth1|59222|estExt_Genewise1.C_10482
Sequence length 181
Sequence
MADQPETGLPPNWEVRHSQSKNLPYYFNSAEKISRWEPPSGTDTEKLKIYMAKYHSNKGL
PAGTGEERQPGKIRCAHLLVKHRDSRRPSSWRENTITRSKEEAYEIIKSYEARIKSGEIS
LGQLALTESDCSSARKQGDLGFFGRGDMQKEFEDAAFALREGEISGIVDTASGLHLIERL
E
Download sequence
Identical sequences G2Q766
XP_003660889.1.50100 jgi|Spoth1|59222|estExt_Genewise1.C_10482

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]