SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Spoth1|99396|fgenesh1_pm.2_#_840 from Sporotrichum thermophile ATCC 42464

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Spoth1|99396|fgenesh1_pm.2_#_840
Domain Number 1 Region: 5-302
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 3.25e-82
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.000000821
Further Details:      
 
Domain Number 2 Region: 489-552,597-737
Classification Level Classification E-value
Superfamily ITPase-like 1.11e-40
Family Maf-like 0.00014
Further Details:      
 
Domain Number 3 Region: 303-402
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 0.00000000000000332
Family Anticodon-binding domain of Class II aaRS 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Spoth1|99396|fgenesh1_pm.2_#_840
Sequence length 755
Sequence
MTSIYSPGSPILLPNGARIFNRLVDFLRQQYVRYGFQEVITPTIYKKALWAKSGHLENYA
DDMYTVTSTSPSRAEVTEGGEEAEYGLKPMNCPGHCLIFASQTRSYRDLPIRYADFSPLH
RNEISGALSGLTRVRRFHQDDGHIFCRPSQIREEISKTLDFVRLTYRVLGLGPYRLVLST
RPEQYIGSAEDWAQAEGALRTALTESGHDYTVSEGDGAFYGPKIDIILKDSDGKEHQTAT
IQLDFQLPKRFNLEYTAPAPEYERRGETTTDPKLLAEYGPVQPVLIHRAVLGSAERLMAL
LIEHYNWKWPFWLNPRQAIVITVNSTEPVVDWARQTRDLLLGVSPSSSSSTTTELASPTG
LAVDFDDSDRSVGLKVREATTKGYGLIVAVGPRDVENKTVGVNATALAKPGASAEELKRL
KRMDMTPEKLREYMLSLKINEAMDLTNPSDPPPDYITATRAHGVPLRQSAPIRKGPFPLE
LPILSYLRSKRVILASASPRRRALLLQLGLTNLEIIPSNEPEDLDKKAHTPEEYVAATAQ
RKCLAVYQAALDRQQEAAENKNNNKEKKKEEEEEEKEEDKEGSSGANANANAKPNPNPRE
LEDPAVVIAADTVIATRGGQILEKPRSEAEHVRMLKHLRDTVRHRVLTGVCVLAPKADAS
HPGYELASHVEETRVFFAGADDGLPDDVIESYVRTREGADKAGGYAIQGVGGMVLVDRVE
GSVDNVVGLPVRKCLQLCEKVVFRQGHDDEEGEDE
Download sequence
Identical sequences G2Q0X4
jgi|Spoth1|99396|fgenesh1_pm.2_#_840 XP_003659317.1.50100

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]