SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Spoth1|40719|e_gw1.1.439.1 from Sporotrichum thermophile ATCC 42464

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Spoth1|40719|e_gw1.1.439.1
Domain Number 1 Region: 13-346
Classification Level Classification E-value
Superfamily DAK1/DegV-like 1.88e-98
Family DAK1 0.00000667
Further Details:      
 
Domain Number 2 Region: 380-591
Classification Level Classification E-value
Superfamily DhaL-like 4.97e-45
Family DhaL-like 0.00052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Spoth1|40719|e_gw1.1.439.1
Sequence length 598
Sequence
MSNRHLFPTLDGLVPKALRGIVASNPRLNLDETNRVIYDPSSSPSNVSIISGGGSGHEPA
WSGYVGANMLSAAVAGDVFASPSTKQILAAVDAVPSDKGTLLVITNYTGDCLHFGLAAEK
TKAKGKACRLLICGDDVSIGKKGGSLVGRRGLAGQIGVLKILGAAAAEGASLDELYDLGT
AVNSQIVSIAATLDHCHVPGRTEHGALQEDEVEIGTGPHNEPGYRKLTPAPTAEGLVKEI
LKYCLDETDPERGYVNFKAGDETALLVSNFGGMSNLELGGLVDELLQQLLKDWNIQPVRV
YAGCLETSLNAPAFSVSIFNLSGIAANSAYSLEQIKGFLDLKTDTAWEAVAGAQSYPQRR
PRAEQLVQAPSAESKKAVDDARDVKVDPALLERMLRGACEAVIAAEPDLTRWDTVMGDGD
CGLTLKTGATALLDAIGSKKIAARGSVVEVLAELEEIVEGKMGGTLGGILGIFFVSLRAA
VQENSALAEAEGPVAVWSRALETAVQHLAHYTPAKAGDRTVMDTLIPFAEAMGAKQSFEE
GVAAAVSGAEATKTMRPRLGRATYVGVGAEGKELPPDPGAWGAMVAIRGLKTAIISNY
Download sequence
Identical sequences G2Q228
jgi|Spoth1|40719|e_gw1.1.439.1 XP_003660306.1.50100

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]