SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Spoth1|67032|estExt_Genewise1.C_41018 from Sporotrichum thermophile ATCC 42464

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Spoth1|67032|estExt_Genewise1.C_41018
Domain Number 1 Region: 1-93
Classification Level Classification E-value
Superfamily Pre-PUA domain 9.15e-30
Family Nip7p homolog, N-terminal domain 0.00014
Further Details:      
 
Domain Number 2 Region: 96-171
Classification Level Classification E-value
Superfamily PUA domain-like 3.48e-24
Family PUA domain 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Spoth1|67032|estExt_Genewise1.C_41018
Sequence length 183
Sequence
MRPLTDQEMKTVLDKLANYMSDLKSLIAPLEDGDRYVFRLNHSRVYYVKLSIANLATCVS
RDALLSLGTCLGKMTKSGKFRLHITALPIIAAGARHKIWVKDNGAQPFLYGSNVVKAHVG
RWSEDCPEHQGCVVYNMADIPLGFGVTARSTTEARRLDPTGIVCFRQADCGEYLRDEDTL
FAG
Download sequence
Identical sequences G2QCG0
XP_003663381.1.50100 jgi|Spoth1|67032|estExt_Genewise1.C_41018

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]