SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Spoth1|78188|estExt_Genewise1Plus.C_30296 from Sporotrichum thermophile ATCC 42464

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Spoth1|78188|estExt_Genewise1Plus.C_30296
Domain Number 1 Region: 27-108,193-413
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 1.34e-51
Family IF2B-like 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Spoth1|78188|estExt_Genewise1Plus.C_30296
Sequence length 427
Sequence
MAPSQATHVPNLDGLIKSFGSRSLEASVESLIFLLKRRQVKGDECAKATAHILRQVVAKS
RWNDVDQLLFRVQSTGSRLVRAAPLEPVIGNVVRRVLGLIRDEASEERNADDLVSEAASD
IQSLSPSTHPPPQRPAPVPVPVPVRPSPSAISTGLQVSKSMFNLLSVADPGDSPITGAST
PMSQAQPASLHALRSEVMDGIEEILDEINQADDQIAGFSEIQIHPGDYVLAYQPTRTVER
FLVKAASKRKFTVIIAGLEYPDGTAEAPYAALRKKLNAAGVNTINLASNGLMAYIPRVNK
VIFSAKAVYQNGGLLVDSGCCIAAQAAHEYLKPVIVLCPVYKFCPEDPSDEVSRGELGNP
SSYVSYANGPAVEALDVENTVTDYIPPELVDVYLTNLGPQTRHHLASILADHYKTEDIGF
SMQLGEP
Download sequence
Identical sequences G2Q8F8
XP_003662306.1.50100 jgi|Spoth1|78188|estExt_Genewise1Plus.C_30296

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]