SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Spoth1|83533|estExt_Genewise1Plus.C_60823 from Sporotrichum thermophile ATCC 42464

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Spoth1|83533|estExt_Genewise1Plus.C_60823
Domain Number 1 Region: 3-372
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 2.6e-106
Family IF2B-like 0.000000196
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Spoth1|83533|estExt_Genewise1Plus.C_60823
Sequence length 389
Sequence
MASLQAIKYSRGKLLVLDQLRLPHEHHYDEVSTAEEAFDCIRSMRVRGAPAIAIVAALAH
AVELHNGGCTATTPEDTIAYIESRLDYLKESRPTAVDLSNAITLLKRAARAAKIEGLGHP
EAKEAILNSYIEAAEKILAKDLENNTSIGSFGAAWLQQQYNATPDRPLSVLTHCNTGSLA
TSGHGTALGIIRTLHAQKLLKHAYCTETRPYNQGSRLTSFELVFEGIPATLITDSMAAAL
FALHRERMNIGAVIVGADRVVRNGDTANKIGTYALAVLARHHGIKFVVAAPTTSIDLETE
SGEGIKIEERKPEELTQISGAVVNDDGTVDTSRAARVAIADQRIDVWNPAFDVTPHALID
AIVTERGTVVKRADGRFNFSQVLPERWRW
Download sequence
Identical sequences G2QKJ6
jgi|Spoth1|83533|estExt_Genewise1Plus.C_60823 XP_003665347.1.50100

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]