SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YBR295W from Saccharomyces cerevisiae AWRI1631

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YBR295W
Domain Number 1 Region: 900-919,956-1202
Classification Level Classification E-value
Superfamily HAD-like 4.12e-32
Family Meta-cation ATPase, catalytic domain P 0.0028
Further Details:      
 
Domain Number 2 Region: 698-792
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 4.32e-20
Family Calcium ATPase, transduction domain A 0.0046
Further Details:      
 
Domain Number 3 Region: 631-693,793-895
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 0.0000000000654
Family Calcium ATPase, transmembrane domain M 0.022
Further Details:      
 
Domain Number 4 Region: 408-471
Classification Level Classification E-value
Superfamily HMA, heavy metal-associated domain 0.000000419
Family HMA, heavy metal-associated domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) YBR295W
Sequence length 1216
Comment PCA1 ORF Verified Cadmium transporting P-type ATPase; may also have a role in copper and iron homeostasis; stabilized by Cd binding, which prevents ubiquitination; S288C and other lab strains contain a G970R mutation which eliminates Cd transport function
Sequence
MKPEKLFSGLGTSDGEYGVVNSENISIDAMQDNRGECHRRSIEMHANDNLGLVSQRDCTN
RPKITPQECLSETEQICHHGENRTKAGLDVDDAETGGDHTNESRVDECCAEKVNDTETGL
DVDSCCGDAQTGGDHTNESCVDGCCVRDSSVMVEEVTGSCEAVSSKEQLLTSFEVVPSKS
EGLQSIHDIRETTRCNTNSNQHTGKGRLCIESSDSTLKKRSCKVSRQKIEVSSKPECCNI
SCVERIESRSCEKRTFKGSTNVGISGSSSTDSLSEKFFSEQYSRMYNRYSSILKNLGCIC
NYLRTLGKESCCLPKVRFCSGEGASKKTKYSYRNSSGCLTKKKTHGDKGRLSNDNGHADF
VCSKSCCTKMKDCAVTSTISGHSSSEISRIVSMEPIENHLNLEAGSTGTEHIVLSVSGMS
CTGCESKLKKSFGALKCVHGLKTSLILSQAEFNLDLAQGSVKDVIKHLSKTTEFKYEQIS
NHGSTIDVVVPYAAKDFINEEWPQGVTELKIVERNIIRIYFDPKVIGARDLVNEGWSVPV
SIAPFSCHPTIEVGRKHLVRVGCTTALSIILTIPILVMAWAPQLREKISTISASMVLATI
IQFVIAGPFYLNALKSLIFSRLIEMDLLIVLSTSAAYIFSIVSFGYFVVGRPLSTEQFFE
TSSLLVTLIMVGRFVSELARHRAVKSISVRSLQASSAILVDKTGKETEINIRLLQYGDIF
KVLPDSRIPTDGTVISGSSEVDEALITGESMPVPKKCQSIVVAGSVNGTGTLFVKLSKLP
GNNTISTIATMVDEAKLTKPKIQNIADKIASYFVPTIIGITVVTFCVWIAVGIRVEKQSR
SDAVIQAIIYAITVLIVSCPCVIGLAVPIVFVIASGVAAKRGVIFKSAESIEVAHNTSHV
VFDKTGTLTEGKLTVVHETVRGDRHNSQSLLLGLTEGIKHPVSMAIASYLKEKGVSAQNV
SNTKAVTGKGVEGTSYSGLKLQGGNCRWLGHNNDPDVRKALEQGYSVFCFSVNGSVTAVY
ALEDSLRADAVSTINLLRQRGISLHILSGDDDGAVRSMAARLGIESSNIRSHATPAEKSE
YIKDIVEGRNCDSSSQSKRPVVVFCGDGTNDAIGLTQATIGVHINEGSEVAKLAADVVML
KPKLNNILTMITVSQKAMFRVKLNFLWSFTYNLFAILLAAGAFVDFHIPPEYAGLGELVS
ILPVIFVAILLRYAKI
Download sequence
Identical sequences B5VEN9
YBR295W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]