SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YDR449C from Saccharomyces cerevisiae AWRI1631

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YDR449C
Domain Number 1 Region: 22-191
Classification Level Classification E-value
Superfamily TPR-like 0.0000000000000303
Family HAT/Suf repeat 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) YDR449C
Sequence length 440
Comment UTP6 ORF Verified Nucleolar protein, component of the small subunit (SSU) processome containing the U3 snoRNA that is involved in processing of pre-18S rRNA
Sequence
MSKTRYYLEQCIPEMDDLVEKGLFTKNEVSLIMKKRTDFEHRLNSRGSSINDYIKYINYE
SNVNKLRAKRCKRILQVKKTNSLSDWSIQQRIGFIYQRGTNKFPQDLKFWAMYLNYMKAR
GNQTSYKKIHNIYNQLLKLHPTNVDIWISCAKYEYEVHANFKSCRNIFQNGLRFNPDVPK
LWYEYVKFELNFITKLINRRKVMGLINEREQELDMQNEQKNNQAPDEEKSHLQVPSTGDS
MKDKLNELPEADISVLGNAETNPALRGDIALTIFDVCMKTLGKHYINKHKGYYAISDSKM
NIELNKETLNYLFSESLRYIKLFDEFLDLERDYLINHVLQFWKNDMYDLSLRKDLPELYL
KTVMIDITLNIRYMPVEKLDIDQLQLSVKKYFAYISKLDSASVKSLKNEYRSYLQDNYLK
KMNAEDDPRYKILDLIISKL
Download sequence
Identical sequences B3LFL3 B5VGY0 C7GKP1 C8Z607 E7KM74 E7NGA5 H0GEP6 N1P7I7 Q02354
YDR449C 355024 YDR449C 4932.YDR449C SCRT_00090 YDR449C YDR449C YDR449C YDR449C NP_010737.1.97178 YDR449C YDR449C YDR449C YDR449C YDR449C YDR449C YDR449C YDR449C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]