SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|443619147|ref|YP_007383003.1| from Escherichia coli APEC O78

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|443619147|ref|YP_007383003.1|
Domain Number 1 Region: 1-362
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 4.51e-110
Family FMN-linked oxidoreductases 0.0000000000105
Further Details:      
 
Domain Number 2 Region: 333-519
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 1.06e-41
Family N-terminal domain of adrenodoxin reductase-like 0.00000032
Further Details:      
 
Domain Number 3 Region: 467-627
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 5.99e-27
Family C-terminal domain of adrenodoxin reductase-like 0.0000000722
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|443619147|ref|YP_007383003.1|
Sequence length 672
Comment 2,4-dienoyl-CoA reductase [Escherichia coli APEC O78]
Sequence
MSYPSLFAPLDLGFTTLKNRVLMGSMHTGLEEYPDGAERLAAFYAERARHGVALIVSGGI
APDLTGVGMEGGAMLNDASQIPHHRTITEAVHQEGGKIALQILHTGRYSYQPHLVAPSAF
QAPINRFVPHELTHEEILQLIDDFARCAQLAREAGYDGVEVMGSEGYLINEFLTLRTNQR
SDQWGGDYRNRMRFAVEVVRAVRERVGNDFIIIYRLSMLDLVEGGGTFAETVELAQAIEA
AGATIINTGIGWHEARIPTIATPVPRGAFTWVTRKLKGHVSLPLVTTNRINDPQVADDIL
SRGDADMVSMARPFLADAELLSKAQSGRADEINTCIGCNQACLDQIFVGKVTSCLVNPRA
CHETKMPILPAVQKKNLAVVGAGPAGLAFAINAAARGHQVTLFDAHSEIGGQFNIAKQIP
GKEEFYETLRYYHRMIEVTGVTLKLNHTVTADQLQAFDETILASGIVPRVPPIDGIDHPK
VLSYLDVLRDKAPVGNKVAIIGCGGIGFDTAMYLSQPGESTSQNIARFCNEWGIDSSLQQ
AGGLSPQGMQIPRSPRQIVMLQRKASKPGQGLGKTTGWIHRTTLLSRGVKMIPSVSYQKI
DDDGLHVVINGETQVLAVDNVVICAGQEPNRALAQPLIDSGKTVHLIGGCDVAMELDARR
AIAQGTRLALEI
Download sequence
Identical sequences D7XRS4 E1J0Q1 E6BFC5 J7Q9T8 J7RL69
WP_000121423.1.100044 WP_000121423.1.101900 WP_000121423.1.10988 WP_000121423.1.11121 WP_000121423.1.13278 WP_000121423.1.14536 WP_000121423.1.15600 WP_000121423.1.16154 WP_000121423.1.16992 WP_000121423.1.18226 WP_000121423.1.1867 WP_000121423.1.19114 WP_000121423.1.19478 WP_000121423.1.22875 WP_000121423.1.23105 WP_000121423.1.23285 WP_000121423.1.27175 WP_000121423.1.27504 WP_000121423.1.29013 WP_000121423.1.30253 WP_000121423.1.31431 WP_000121423.1.3398 WP_000121423.1.34032 WP_000121423.1.34605 WP_000121423.1.36393 WP_000121423.1.37020 WP_000121423.1.37329 WP_000121423.1.38584 WP_000121423.1.40238 WP_000121423.1.41417 WP_000121423.1.41651 WP_000121423.1.42179 WP_000121423.1.42918 WP_000121423.1.43389 WP_000121423.1.43804 WP_000121423.1.46097 WP_000121423.1.47356 WP_000121423.1.47770 WP_000121423.1.47848 WP_000121423.1.48505 WP_000121423.1.49482 WP_000121423.1.51430 WP_000121423.1.52249 WP_000121423.1.53505 WP_000121423.1.53592 WP_000121423.1.54013 WP_000121423.1.54144 WP_000121423.1.55560 WP_000121423.1.56882 WP_000121423.1.57124 WP_000121423.1.59423 WP_000121423.1.59730 WP_000121423.1.59756 WP_000121423.1.59823 WP_000121423.1.60228 WP_000121423.1.60805 WP_000121423.1.60927 WP_000121423.1.63189 WP_000121423.1.63703 WP_000121423.1.64321 WP_000121423.1.64519 WP_000121423.1.65672 WP_000121423.1.67788 WP_000121423.1.67999 WP_000121423.1.68336 WP_000121423.1.69144 WP_000121423.1.70900 WP_000121423.1.73743 WP_000121423.1.7424 WP_000121423.1.75594 WP_000121423.1.76918 WP_000121423.1.79936 WP_000121423.1.80756 WP_000121423.1.8121 WP_000121423.1.82074 WP_000121423.1.82626 WP_000121423.1.84929 WP_000121423.1.8579 WP_000121423.1.87726 WP_000121423.1.87834 WP_000121423.1.89305 WP_000121423.1.89788 WP_000121423.1.92953 WP_000121423.1.93637 WP_000121423.1.97238 WP_000121423.1.97360 WP_000121423.1.97490 WP_000121423.1.9844 WP_000121423.1.99209 WP_000121423.1.99292 gi|443619147|ref|YP_007383003.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]