SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|443618580|ref|YP_007382436.1| from Escherichia coli APEC O78

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|443618580|ref|YP_007382436.1|
Domain Number 1 Region: 14-108
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 5.74e-53
Family 2Fe-2S ferredoxin-related 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|443618580|ref|YP_007382436.1|
Sequence length 111
Comment 2Fe-2S ferredoxin [Escherichia coli APEC O78]
Sequence
MPKIVILPHQDLCPDGAVLEANSGETILDAALRNGIEIEHACEKSCACTTCHCIVREGFD
SLPESSEQEDDMLDKAWGLEPESRLSCQARVTDEDLVVEIPRYTINHAREH
Download sequence
Identical sequences A0A017ICC5 A0A023Z109 A0A025CE01 A0A026UJM4 A0A027TYE0 A0A028ATG5 A0A028E2P1 A0A069XKV9 A0A070FFH2 A0A070SSG6 A0A073FUF2 A0A074IEX3 A0A080FRN8 A0A080IV34 A0A0A0FFM9 A0A0A8UBX2 A0A0E0U1J9 A0A0E0V8K3 A0A0E0XW37 A0A0E1M016 A0A0E2TY95 A0A0F6C7K9 A0A0F6FAP1 A0A0F6MFW1 A0A0H3MJC9 A0A0H3PWA0 A0A0I5FRQ0 A0A0M7NPJ4 A0A125X0I7 A0A127GN68 A0A140N9N6 A0A142H5E8 A0A1E2VRI5 A0A1Q8MP78 A0A1Q8NWG8 A0A1S6TDR8 A0A1W2MZ15 A0A1X3J2T9 A0A1X3JF83 A0A1X3KKQ5 A0A1X3LGE4 A0A1Z3V0X9 A0A222QP58 A0A226KCG2 A0A2H1BID5 B1LNI0 B2TXV0 B3WYF0 B6I597 B7LDB7 C3SZR7 C8U844 C8UE93 D2AGX0 D3QN16 D6HZT7 D6I9W1 D7XMX3 D7Y9N5 D8AEH4 D8E2F0 E0J4N5 E1INB6 E1J3K5 E6BGV0 E7SK14 E7SY15 E7TA36 E9TBW1 F3V8G0 F3WKR6 F4NGQ4 F4SHX0 F4VEZ5 F5N5M2 F5NY30 G0FFZ4 H4UMG4 I0VTD0 I2S1K1 I2SXB0 I2USZ8 I2WGW1 I2WVA2 I2XDK7 I4T780 I6BHJ4 I6CI46 I6D7U8 I6DW82 I6FN63 I6GYZ8 J7RTU7 K0X9H5 K4UX15 K4W6V2 L3C5N3 L4V8D2 P0A9R4 P0A9R5 P0A9R6 Q0T1Z4 Q31XW5 Q3YZ27 R8XLU3 S0U0E7 S0WQV8 S0XZK1 S0YXH9 S1DDH8 S1F3N3 S1HE15 S1HQ76 S1INV4 T6LKE2 T8K2L8 U9XMH8 U9ZPI0 V0TC69 V0XJE0 V6FVF3 V8FIY7 W1B5D0 W1F484
gi|251785852|ref|YP_003000156.1| gi|15803052|ref|NP_289082.1| gi|24113854|ref|NP_708364.1| gi|387507894|ref|YP_006160150.1| gi|82544974|ref|YP_408921.1| gi|386705790|ref|YP_006169637.1| gi|386625263|ref|YP_006144991.1| cath|current|1i7hA00/2-110 cath|current|1i7hB00/2-110 cath|current|1i7hC00/2-109 gi|410481483|ref|YP_006769029.1| gi|260869214|ref|YP_003235616.1| gi|253772579|ref|YP_003035410.1| gi|387883723|ref|YP_006314025.1| gi|209399066|ref|YP_002271999.1| gi|378712014|ref|YP_005276907.1| gi|260845155|ref|YP_003222933.1| gi|407480917|ref|YP_006778066.1| 155864.Z3792 198214.SF2572 198215.S2744 300268.SBO_2549 300269.SSON_2607 316385.ECDH10B_2692 316407.fdx 331112.EcHS_A2676 344609.SbBS512_E2900 373384.SFV_2573 386585.ECs3391 409438.ECSE_2811 413997.ECB_02417 439855.EcSMS35_2677 444450.ECH74115_3756 469008.ECBD_1159 481805.EcolC_1152 511145.b2525 544404.ECSP_3469 573235.ECO26_3572 585034.ECIAI1_2577 585055.EC55989_2810 585057.ECIAI39_2726 585395.ECO103_3042 585396.ECO111_3249 595496.BWG_2289 gi|170019192|ref|YP_001724146.1| gi|218696152|ref|YP_002403819.1| gi|378712014|ref|YP_005276907.1| gi|443618580|ref|YP_007382436.1| gi|387622225|ref|YP_006129853.1| gi|218555050|ref|YP_002387963.1| gi|291283750|ref|YP_003500568.1| NP_311418.1.58667 NP_417020.1.90541 NP_708364.1.23235 WP_001124469.1.1000 WP_001124469.1.10001 WP_001124469.1.100044 WP_001124469.1.100063 WP_001124469.1.100066 WP_001124469.1.100073 WP_001124469.1.100085 WP_001124469.1.10010 WP_001124469.1.100111 WP_001124469.1.100116 WP_001124469.1.100135 WP_001124469.1.100159 WP_001124469.1.100185 WP_001124469.1.100252 WP_001124469.1.100283 WP_001124469.1.100285 WP_001124469.1.100299 WP_001124469.1.100302 WP_001124469.1.100315 WP_001124469.1.10034 WP_001124469.1.100346 WP_001124469.1.100389 WP_001124469.1.100425 WP_001124469.1.100441 WP_001124469.1.100444 WP_001124469.1.100447 WP_001124469.1.100448 WP_001124469.1.100451 WP_001124469.1.10048 WP_001124469.1.100496 WP_001124469.1.100499 WP_001124469.1.100508 WP_001124469.1.10051 WP_001124469.1.100543 WP_001124469.1.100554 WP_001124469.1.100571 WP_001124469.1.100573 WP_001124469.1.100614 WP_001124469.1.100667 WP_001124469.1.10067 WP_001124469.1.10068 WP_001124469.1.100689 WP_001124469.1.100718 WP_001124469.1.100725 WP_001124469.1.100752 WP_001124469.1.100753 WP_001124469.1.100758 WP_001124469.1.100778 WP_001124469.1.100796 WP_001124469.1.10080 WP_001124469.1.100803 WP_001124469.1.100824 WP_001124469.1.100836 WP_001124469.1.100851 WP_001124469.1.100852 WP_001124469.1.10086 WP_001124469.1.100867 WP_001124469.1.100925 WP_001124469.1.100928 WP_001124469.1.100933 WP_001124469.1.10094 WP_001124469.1.100990 WP_001124469.1.101033 WP_001124469.1.101096 WP_001124469.1.101102 WP_001124469.1.101105 WP_001124469.1.101110 WP_001124469.1.101121 WP_001124469.1.101157 WP_001124469.1.101158 WP_001124469.1.101166 WP_001124469.1.101175 WP_001124469.1.101186 WP_001124469.1.101206 WP_001124469.1.101214 WP_001124469.1.101216 WP_001124469.1.101255 WP_001124469.1.101257 WP_001124469.1.10126 WP_001124469.1.101282 WP_001124469.1.101289 WP_001124469.1.101293 WP_001124469.1.101313 WP_001124469.1.101359 WP_001124469.1.101387 WP_001124469.1.101418 WP_001124469.1.101423 WP_001124469.1.101436 WP_001124469.1.101445 WP_001124469.1.101468 WP_001124469.1.101486 WP_001124469.1.101518 WP_001124469.1.101522 WP_001124469.1.10154 WP_001124469.1.101545 WP_001124469.1.101583 WP_001124469.1.101594 WP_001124469.1.101628 WP_001124469.1.101630 WP_001124469.1.101653 WP_001124469.1.101654 WP_001124469.1.101667 WP_001124469.1.101668 WP_001124469.1.101686 WP_001124469.1.101727 WP_001124469.1.10173 WP_001124469.1.101737 WP_001124469.1.101747 WP_001124469.1.101777 WP_001124469.1.101786 WP_001124469.1.101822 WP_001124469.1.10184 WP_001124469.1.101840 WP_001124469.1.101845 WP_001124469.1.101865 WP_001124469.1.10187 WP_001124469.1.10188 WP_001124469.1.101887 WP_001124469.1.101889 WP_001124469.1.10190 WP_001124469.1.101900 WP_001124469.1.101908 WP_001124469.1.101913 WP_001124469.1.101937 WP_001124469.1.101940 WP_001124469.1.101942 WP_001124469.1.101947 WP_001124469.1.101952 WP_001124469.1.101964 WP_001124469.1.101969 WP_001124469.1.101987 WP_001124469.1.102021 WP_001124469.1.10206 WP_001124469.1.102069 WP_001124469.1.102093 WP_001124469.1.102094 WP_001124469.1.102122 WP_001124469.1.102139 WP_001124469.1.10222 WP_001124469.1.10226 WP_001124469.1.10233 WP_001124469.1.10252 WP_001124469.1.10273 WP_001124469.1.10304 WP_001124469.1.10329 WP_001124469.1.10335 WP_001124469.1.10348 WP_001124469.1.10352 WP_001124469.1.10361 WP_001124469.1.10379 WP_001124469.1.1040 WP_001124469.1.10400 WP_001124469.1.10417 WP_001124469.1.10461 WP_001124469.1.10476 WP_001124469.1.10491 WP_001124469.1.10496 WP_001124469.1.10508 WP_001124469.1.10524 WP_001124469.1.10525 WP_001124469.1.10538 WP_001124469.1.10569 WP_001124469.1.10576 WP_001124469.1.10579 WP_001124469.1.10607 WP_001124469.1.10628 WP_001124469.1.10651 WP_001124469.1.10673 WP_001124469.1.1071 WP_001124469.1.10715 WP_001124469.1.1073 WP_001124469.1.1074 WP_001124469.1.10761 WP_001124469.1.10763 WP_001124469.1.10771 WP_001124469.1.10798 WP_001124469.1.10824 WP_001124469.1.10833 WP_001124469.1.10862 WP_001124469.1.10922 WP_001124469.1.10940 WP_001124469.1.10970 WP_001124469.1.10988 WP_001124469.1.10989 WP_001124469.1.10994 WP_001124469.1.10995 WP_001124469.1.11006 WP_001124469.1.11032 WP_001124469.1.11047 WP_001124469.1.11052 WP_001124469.1.11071 WP_001124469.1.11091 WP_001124469.1.1111 WP_001124469.1.11118 WP_001124469.1.11121 WP_001124469.1.1113 WP_001124469.1.11133 WP_001124469.1.112 WP_001124469.1.1122 WP_001124469.1.11240 WP_001124469.1.11251 WP_001124469.1.11272 WP_001124469.1.11296 WP_001124469.1.11301 WP_001124469.1.11323 WP_001124469.1.11418 WP_001124469.1.11420 WP_001124469.1.11436 WP_001124469.1.11437 WP_001124469.1.11440 WP_001124469.1.11452 WP_001124469.1.11499 WP_001124469.1.11524 WP_001124469.1.11542 WP_001124469.1.11578 WP_001124469.1.11595 WP_001124469.1.11616 WP_001124469.1.11645 WP_001124469.1.11671 WP_001124469.1.11673 WP_001124469.1.1168 WP_001124469.1.11690 WP_001124469.1.11699 WP_001124469.1.11748 WP_001124469.1.11759 WP_001124469.1.1176 WP_001124469.1.11762 WP_001124469.1.11801 WP_001124469.1.11803 WP_001124469.1.11844 WP_001124469.1.1186 WP_001124469.1.11912 WP_001124469.1.11949 WP_001124469.1.11955 WP_001124469.1.1196 WP_001124469.1.11982 WP_001124469.1.11985 WP_001124469.1.12000 WP_001124469.1.12030 WP_001124469.1.12036 WP_001124469.1.12051 WP_001124469.1.12060 WP_001124469.1.12095 WP_001124469.1.12112 WP_001124469.1.1212 WP_001124469.1.1218 WP_001124469.1.12204 WP_001124469.1.12259 WP_001124469.1.12279 WP_001124469.1.12292 WP_001124469.1.12305 WP_001124469.1.12320 WP_001124469.1.12342 WP_001124469.1.12344 WP_001124469.1.12415 WP_001124469.1.1242 WP_001124469.1.12426 WP_001124469.1.12458 WP_001124469.1.12468 WP_001124469.1.12478 WP_001124469.1.12542 WP_001124469.1.12552 WP_001124469.1.12558 WP_001124469.1.12566 WP_001124469.1.12582 WP_001124469.1.12594 WP_001124469.1.12623 WP_001124469.1.12645 WP_001124469.1.12675 WP_001124469.1.12679 WP_001124469.1.12693 WP_001124469.1.127 WP_001124469.1.12717 WP_001124469.1.12743 WP_001124469.1.12749 WP_001124469.1.1275 WP_001124469.1.12756 WP_001124469.1.12762 WP_001124469.1.12766 WP_001124469.1.1280 WP_001124469.1.12831 WP_001124469.1.12876 WP_001124469.1.12911 WP_001124469.1.12914 WP_001124469.1.1295 WP_001124469.1.12965 WP_001124469.1.12979 WP_001124469.1.12987 WP_001124469.1.13002 WP_001124469.1.13015 WP_001124469.1.13031 WP_001124469.1.13060 WP_001124469.1.13074 WP_001124469.1.1312 WP_001124469.1.13136 WP_001124469.1.13144 WP_001124469.1.1315 WP_001124469.1.13157 WP_001124469.1.13162 WP_001124469.1.13176 WP_001124469.1.13217 WP_001124469.1.13222 WP_001124469.1.13223 WP_001124469.1.13239 WP_001124469.1.13252 WP_001124469.1.13258 WP_001124469.1.13278 WP_001124469.1.13281 WP_001124469.1.13301 WP_001124469.1.13332 WP_001124469.1.13333 WP_001124469.1.13346 WP_001124469.1.13348 WP_001124469.1.1335 WP_001124469.1.13383 WP_001124469.1.13411 WP_001124469.1.13430 WP_001124469.1.13437 WP_001124469.1.13442 WP_001124469.1.1345 WP_001124469.1.13451 WP_001124469.1.13481 WP_001124469.1.13492 WP_001124469.1.13495 WP_001124469.1.13525 WP_001124469.1.13566 WP_001124469.1.13585 WP_001124469.1.13589 WP_001124469.1.13601 WP_001124469.1.13608 WP_001124469.1.13618 WP_001124469.1.13624 WP_001124469.1.13644 WP_001124469.1.13664 WP_001124469.1.13672 WP_001124469.1.13740 WP_001124469.1.13791 WP_001124469.1.13798 WP_001124469.1.13824 WP_001124469.1.13867 WP_001124469.1.13877 WP_001124469.1.13881 WP_001124469.1.13891 WP_001124469.1.13924 WP_001124469.1.13936 WP_001124469.1.13939 WP_001124469.1.13949 WP_001124469.1.13974 WP_001124469.1.13981 WP_001124469.1.14030 WP_001124469.1.14058 WP_001124469.1.14062 WP_001124469.1.14070 WP_001124469.1.14094 WP_001124469.1.14110 WP_001124469.1.14127 WP_001124469.1.14129 WP_001124469.1.14154 WP_001124469.1.14199 WP_001124469.1.142 WP_001124469.1.14253 WP_001124469.1.14277 WP_001124469.1.14292 WP_001124469.1.14299 WP_001124469.1.14304 WP_001124469.1.14346 WP_001124469.1.14389 WP_001124469.1.1439 WP_001124469.1.14398 WP_001124469.1.14417 WP_001124469.1.14432 WP_001124469.1.14451 WP_001124469.1.14453 WP_001124469.1.14493 WP_001124469.1.14499 WP_001124469.1.14501 WP_001124469.1.14508 WP_001124469.1.14529 WP_001124469.1.14536 WP_001124469.1.14582 WP_001124469.1.14601 WP_001124469.1.1461 WP_001124469.1.14621 WP_001124469.1.14648 WP_001124469.1.14661 WP_001124469.1.14672 WP_001124469.1.14678 WP_001124469.1.14693 WP_001124469.1.14711 WP_001124469.1.14748 WP_001124469.1.14811 WP_001124469.1.14833 WP_001124469.1.1486 WP_001124469.1.14861 WP_001124469.1.14871 WP_001124469.1.14879 WP_001124469.1.14914 WP_001124469.1.14956 WP_001124469.1.14958 WP_001124469.1.14963 WP_001124469.1.14965 WP_001124469.1.14977 WP_001124469.1.14992 WP_001124469.1.14993 WP_001124469.1.15007 WP_001124469.1.15041 WP_001124469.1.1508 WP_001124469.1.15087 WP_001124469.1.1510 WP_001124469.1.15117 WP_001124469.1.1512 WP_001124469.1.15121 WP_001124469.1.15138 WP_001124469.1.15148 WP_001124469.1.15177 WP_001124469.1.15191 WP_001124469.1.15207 WP_001124469.1.15221 WP_001124469.1.1524 WP_001124469.1.15245 WP_001124469.1.15252 WP_001124469.1.15259 WP_001124469.1.15270 WP_001124469.1.15277 WP_001124469.1.15282 WP_001124469.1.15287 WP_001124469.1.153 WP_001124469.1.15300 WP_001124469.1.15332 WP_001124469.1.15335 WP_001124469.1.15356 WP_001124469.1.15377 WP_001124469.1.15416 WP_001124469.1.15420 WP_001124469.1.15453 WP_001124469.1.15464 WP_001124469.1.15469 WP_001124469.1.15503 WP_001124469.1.15521 WP_001124469.1.15527 WP_001124469.1.15528 WP_001124469.1.15565 WP_001124469.1.15576 WP_001124469.1.15583 WP_001124469.1.15593 WP_001124469.1.15600 WP_001124469.1.15620 WP_001124469.1.15626 WP_001124469.1.15645 WP_001124469.1.15702 WP_001124469.1.15707 WP_001124469.1.15747 WP_001124469.1.15762 WP_001124469.1.15767 WP_001124469.1.15768 WP_001124469.1.15771 WP_001124469.1.15782 WP_001124469.1.15791 WP_001124469.1.1580 WP_001124469.1.15809 WP_001124469.1.1582 WP_001124469.1.1588 WP_001124469.1.15894 WP_001124469.1.15916 WP_001124469.1.15945 WP_001124469.1.15983 WP_001124469.1.15990 WP_001124469.1.16014 WP_001124469.1.16015 WP_001124469.1.16042 WP_001124469.1.16075 WP_001124469.1.16086 WP_001124469.1.16087 WP_001124469.1.1609 WP_001124469.1.16111 WP_001124469.1.16133 WP_001124469.1.16154 WP_001124469.1.16171 WP_001124469.1.16179 WP_001124469.1.16183 WP_001124469.1.16188 WP_001124469.1.16194 WP_001124469.1.1621 WP_001124469.1.16222 WP_001124469.1.16270 WP_001124469.1.16272 WP_001124469.1.16294 WP_001124469.1.163 WP_001124469.1.16303 WP_001124469.1.16387 WP_001124469.1.16388 WP_001124469.1.1640 WP_001124469.1.16463 WP_001124469.1.16481 WP_001124469.1.16482 WP_001124469.1.16500 WP_001124469.1.16517 WP_001124469.1.16532 WP_001124469.1.16541 WP_001124469.1.1655 WP_001124469.1.16577 WP_001124469.1.16592 WP_001124469.1.16604 WP_001124469.1.16612 WP_001124469.1.16640 WP_001124469.1.16648 WP_001124469.1.16669 WP_001124469.1.16682 WP_001124469.1.16715 WP_001124469.1.16721 WP_001124469.1.1673 WP_001124469.1.16745 WP_001124469.1.16752 WP_001124469.1.16805 WP_001124469.1.16845 WP_001124469.1.16861 WP_001124469.1.16862 WP_001124469.1.16894 WP_001124469.1.16970 WP_001124469.1.16992 WP_001124469.1.17017 WP_001124469.1.17018 WP_001124469.1.17042 WP_001124469.1.17084 WP_001124469.1.17085 WP_001124469.1.17087 WP_001124469.1.17089 WP_001124469.1.1710 WP_001124469.1.17101 WP_001124469.1.17102 WP_001124469.1.17109 WP_001124469.1.17111 WP_001124469.1.17114 WP_001124469.1.17119 WP_001124469.1.17123 WP_001124469.1.17150 WP_001124469.1.17153 WP_001124469.1.17170 WP_001124469.1.17172 WP_001124469.1.17182 WP_001124469.1.17186 WP_001124469.1.17187 WP_001124469.1.17205 WP_001124469.1.17216 WP_001124469.1.17230 WP_001124469.1.17241 WP_001124469.1.17242 WP_001124469.1.1726 WP_001124469.1.17267 WP_001124469.1.17282 WP_001124469.1.17297 WP_001124469.1.17300 WP_001124469.1.17301 WP_001124469.1.1731 WP_001124469.1.17356 WP_001124469.1.17360 WP_001124469.1.17373 WP_001124469.1.17386 WP_001124469.1.17389 WP_001124469.1.17392 WP_001124469.1.17403 WP_001124469.1.17410 WP_001124469.1.17415 WP_001124469.1.17417 WP_001124469.1.17432 WP_001124469.1.17441 WP_001124469.1.17464 WP_001124469.1.17515 WP_001124469.1.1754 WP_001124469.1.1755 WP_001124469.1.17550 WP_001124469.1.17570 WP_001124469.1.17577 WP_001124469.1.17595 WP_001124469.1.17623 WP_001124469.1.1763 WP_001124469.1.17637 WP_001124469.1.1766 WP_001124469.1.17680 WP_001124469.1.1769 WP_001124469.1.17701 WP_001124469.1.17711 WP_001124469.1.17734 WP_001124469.1.17757 WP_001124469.1.17765 WP_001124469.1.17766 WP_001124469.1.1778 WP_001124469.1.17802 WP_001124469.1.17829 WP_001124469.1.17831 WP_001124469.1.17836 WP_001124469.1.17904 WP_001124469.1.17920 WP_001124469.1.17937 WP_001124469.1.17952 WP_001124469.1.17961 WP_001124469.1.17963 WP_001124469.1.18000 WP_001124469.1.18006 WP_001124469.1.18064 WP_001124469.1.18094 WP_001124469.1.18112 WP_001124469.1.18134 WP_001124469.1.18136 WP_001124469.1.18141 WP_001124469.1.18164 WP_001124469.1.18175 WP_001124469.1.18225 WP_001124469.1.18226 WP_001124469.1.18275 WP_001124469.1.18311 WP_001124469.1.18326 WP_001124469.1.18338 WP_001124469.1.1834 WP_001124469.1.18340 WP_001124469.1.18354 WP_001124469.1.18381 WP_001124469.1.18402 WP_001124469.1.18410 WP_001124469.1.18436 WP_001124469.1.18438 WP_001124469.1.1844 WP_001124469.1.18458 WP_001124469.1.18482 WP_001124469.1.18511 WP_001124469.1.18519 WP_001124469.1.18530 WP_001124469.1.18550 WP_001124469.1.18583 WP_001124469.1.18588 WP_001124469.1.18628 WP_001124469.1.18649 WP_001124469.1.18650 WP_001124469.1.1866 WP_001124469.1.18666 WP_001124469.1.1867 WP_001124469.1.18675 WP_001124469.1.18699 WP_001124469.1.18714 WP_001124469.1.18725 WP_001124469.1.188 WP_001124469.1.18801 WP_001124469.1.18806 WP_001124469.1.1881 WP_001124469.1.18837 WP_001124469.1.18861 WP_001124469.1.18874 WP_001124469.1.18899 WP_001124469.1.18923 WP_001124469.1.18929 WP_001124469.1.18936 WP_001124469.1.18983 WP_001124469.1.18995 WP_001124469.1.19024 WP_001124469.1.1903 WP_001124469.1.19039 WP_001124469.1.1906 WP_001124469.1.19075 WP_001124469.1.1909 WP_001124469.1.19090 WP_001124469.1.191 WP_001124469.1.19100 WP_001124469.1.19113 WP_001124469.1.19114 WP_001124469.1.19122 WP_001124469.1.19129 WP_001124469.1.19140 WP_001124469.1.19147 WP_001124469.1.19148 WP_001124469.1.1915 WP_001124469.1.19150 WP_001124469.1.19205 WP_001124469.1.19206 WP_001124469.1.1925 WP_001124469.1.19277 WP_001124469.1.19297 WP_001124469.1.193 WP_001124469.1.19312 WP_001124469.1.19313 WP_001124469.1.19314 WP_001124469.1.19315 WP_001124469.1.19332 WP_001124469.1.19338 WP_001124469.1.19347 WP_001124469.1.19350 WP_001124469.1.19361 WP_001124469.1.19374 WP_001124469.1.19397 WP_001124469.1.19419 WP_001124469.1.19424 WP_001124469.1.19448 WP_001124469.1.19453 WP_001124469.1.19478 WP_001124469.1.19487 WP_001124469.1.19494 WP_001124469.1.19544 WP_001124469.1.19557 WP_001124469.1.19581 WP_001124469.1.19583 WP_001124469.1.19602 WP_001124469.1.19612 WP_001124469.1.1963 WP_001124469.1.19644 WP_001124469.1.19651 WP_001124469.1.19661 WP_001124469.1.19684 WP_001124469.1.19758 WP_001124469.1.19778 WP_001124469.1.19795 WP_001124469.1.1982 WP_001124469.1.19838 WP_001124469.1.19840 WP_001124469.1.19845 WP_001124469.1.19847 WP_001124469.1.19873 WP_001124469.1.19878 WP_001124469.1.19889 WP_001124469.1.19940 WP_001124469.1.19945 WP_001124469.1.20025 WP_001124469.1.2005 WP_001124469.1.20096 WP_001124469.1.20114 WP_001124469.1.20129 WP_001124469.1.20136 WP_001124469.1.2015 WP_001124469.1.20157 WP_001124469.1.20159 WP_001124469.1.20164 WP_001124469.1.20166 WP_001124469.1.20170 WP_001124469.1.20178 WP_001124469.1.20192 WP_001124469.1.20215 WP_001124469.1.2022 WP_001124469.1.20230 WP_001124469.1.20251 WP_001124469.1.20264 WP_001124469.1.20290 WP_001124469.1.20308 WP_001124469.1.20325 WP_001124469.1.20334 WP_001124469.1.20370 WP_001124469.1.20449 WP_001124469.1.20480 WP_001124469.1.20483 WP_001124469.1.20484 WP_001124469.1.20515 WP_001124469.1.20519 WP_001124469.1.20536 WP_001124469.1.20546 WP_001124469.1.20549 WP_001124469.1.20594 WP_001124469.1.20596 WP_001124469.1.20609 WP_001124469.1.2063 WP_001124469.1.20630 WP_001124469.1.20636 WP_001124469.1.20638 WP_001124469.1.20662 WP_001124469.1.20668 WP_001124469.1.20691 WP_001124469.1.20730 WP_001124469.1.20737 WP_001124469.1.20745 WP_001124469.1.20765 WP_001124469.1.20785 WP_001124469.1.20813 WP_001124469.1.20824 WP_001124469.1.20831 WP_001124469.1.20848 WP_001124469.1.20893 WP_001124469.1.20907 WP_001124469.1.2093 WP_001124469.1.2094 WP_001124469.1.20941 WP_001124469.1.20950 WP_001124469.1.20958 WP_001124469.1.20982 WP_001124469.1.20989 WP_001124469.1.2100 WP_001124469.1.21017 WP_001124469.1.21020 WP_001124469.1.21022 WP_001124469.1.21024 WP_001124469.1.21029 WP_001124469.1.21033 WP_001124469.1.21041 WP_001124469.1.21057 WP_001124469.1.21059 WP_001124469.1.21104 WP_001124469.1.21122 WP_001124469.1.21129 WP_001124469.1.2113 WP_001124469.1.21131 WP_001124469.1.21137 WP_001124469.1.21171 WP_001124469.1.21197 WP_001124469.1.21248 WP_001124469.1.21277 WP_001124469.1.21305 WP_001124469.1.21320 WP_001124469.1.21336 WP_001124469.1.21441 WP_001124469.1.21470 WP_001124469.1.21508 WP_001124469.1.21519 WP_001124469.1.2156 WP_001124469.1.21573 WP_001124469.1.21578 WP_001124469.1.21596 WP_001124469.1.21628 WP_001124469.1.21637 WP_001124469.1.2164 WP_001124469.1.21656 WP_001124469.1.21666 WP_001124469.1.21667 WP_001124469.1.21668 WP_001124469.1.21673 WP_001124469.1.21727 WP_001124469.1.21732 WP_001124469.1.21733 WP_001124469.1.21758 WP_001124469.1.21762 WP_001124469.1.21771 WP_001124469.1.21811 WP_001124469.1.21812 WP_001124469.1.21823 WP_001124469.1.21887 WP_001124469.1.21895 WP_001124469.1.21915 WP_001124469.1.21948 WP_001124469.1.21962 WP_001124469.1.22060 WP_001124469.1.22098 WP_001124469.1.22113 WP_001124469.1.22138 WP_001124469.1.2218 WP_001124469.1.22195 WP_001124469.1.22204 WP_001124469.1.22251 WP_001124469.1.22268 WP_001124469.1.22269 WP_001124469.1.22280 WP_001124469.1.22291 WP_001124469.1.22295 WP_001124469.1.22304 WP_001124469.1.22314 WP_001124469.1.2232 WP_001124469.1.22325 WP_001124469.1.22328 WP_001124469.1.22350 WP_001124469.1.22359 WP_001124469.1.22363 WP_001124469.1.22381 WP_001124469.1.22409 WP_001124469.1.22450 WP_001124469.1.22470 WP_001124469.1.22494 WP_001124469.1.22501 WP_001124469.1.22522 WP_001124469.1.22544 WP_001124469.1.22571 WP_001124469.1.22572 WP_001124469.1.22594 WP_001124469.1.22599 WP_001124469.1.22631 WP_001124469.1.22632 WP_001124469.1.22641 WP_001124469.1.22662 WP_001124469.1.22669 WP_001124469.1.22685 WP_001124469.1.22690 WP_001124469.1.22743 WP_001124469.1.22756 WP_001124469.1.22765 WP_001124469.1.22771 WP_001124469.1.22777 WP_001124469.1.22783 WP_001124469.1.22809 WP_001124469.1.22827 WP_001124469.1.22830 WP_001124469.1.22846 WP_001124469.1.22868 WP_001124469.1.22875 WP_001124469.1.22885 WP_001124469.1.22896 WP_001124469.1.22908 WP_001124469.1.22925 WP_001124469.1.22961 WP_001124469.1.22990 WP_001124469.1.2300 WP_001124469.1.23005 WP_001124469.1.23026 WP_001124469.1.23035 WP_001124469.1.23042 WP_001124469.1.23044 WP_001124469.1.23045 WP_001124469.1.23057 WP_001124469.1.23062 WP_001124469.1.23073 WP_001124469.1.23078 WP_001124469.1.23081 WP_001124469.1.23090 WP_001124469.1.23092 WP_001124469.1.23105 WP_001124469.1.23115 WP_001124469.1.23120 WP_001124469.1.23135 WP_001124469.1.23241 WP_001124469.1.2325 WP_001124469.1.23257 WP_001124469.1.23270 WP_001124469.1.23285 WP_001124469.1.23290 WP_001124469.1.23293 WP_001124469.1.23299 WP_001124469.1.23323 WP_001124469.1.23330 WP_001124469.1.23352 WP_001124469.1.23355 WP_001124469.1.23376 WP_001124469.1.23378 WP_001124469.1.23388 WP_001124469.1.23393 WP_001124469.1.23443 WP_001124469.1.23456 WP_001124469.1.23467 WP_001124469.1.23486 WP_001124469.1.23487 WP_001124469.1.23511 WP_001124469.1.23520 WP_001124469.1.23527 WP_001124469.1.2353 WP_001124469.1.23554 WP_001124469.1.23561 WP_001124469.1.23563 WP_001124469.1.23584 WP_001124469.1.23593 WP_001124469.1.2362 WP_001124469.1.23622 WP_001124469.1.23640 WP_001124469.1.23660 WP_001124469.1.23676 WP_001124469.1.23693 WP_001124469.1.23724 WP_001124469.1.23729 WP_001124469.1.23741 WP_001124469.1.23754 WP_001124469.1.23765 WP_001124469.1.23790 WP_001124469.1.23795 WP_001124469.1.23806 WP_001124469.1.23812 WP_001124469.1.23838 WP_001124469.1.23855 WP_001124469.1.2388 WP_001124469.1.23881 WP_001124469.1.23886 WP_001124469.1.23895 WP_001124469.1.23898 WP_001124469.1.23899 WP_001124469.1.23914 WP_001124469.1.23915 WP_001124469.1.23931 WP_001124469.1.23945 WP_001124469.1.2395 WP_001124469.1.23950 WP_001124469.1.23970 WP_001124469.1.23971 WP_001124469.1.23973 WP_001124469.1.23984 WP_001124469.1.23985 WP_001124469.1.24 WP_001124469.1.24024 WP_001124469.1.24051 WP_001124469.1.24058 WP_001124469.1.24068 WP_001124469.1.24070 WP_001124469.1.24088 WP_001124469.1.24089 WP_001124469.1.24120 WP_001124469.1.24122 WP_001124469.1.24124 WP_001124469.1.24136 WP_001124469.1.24194 WP_001124469.1.24233 WP_001124469.1.24278 WP_001124469.1.2428 WP_001124469.1.24283 WP_001124469.1.24290 WP_001124469.1.2430 WP_001124469.1.24304 WP_001124469.1.24316 WP_001124469.1.2433 WP_001124469.1.24341 WP_001124469.1.24362 WP_001124469.1.2437 WP_001124469.1.24374 WP_001124469.1.24381 WP_001124469.1.24383 WP_001124469.1.24460 WP_001124469.1.24473 WP_001124469.1.24483 WP_001124469.1.24485 WP_001124469.1.24499 WP_001124469.1.24533 WP_001124469.1.24536 WP_001124469.1.24547 WP_001124469.1.2456 WP_001124469.1.24560 WP_001124469.1.24570 WP_001124469.1.24575 WP_001124469.1.24583 WP_001124469.1.24616 WP_001124469.1.24641 WP_001124469.1.24642 WP_001124469.1.24646 WP_001124469.1.24650 WP_001124469.1.24693 WP_001124469.1.24695 WP_001124469.1.24703 WP_001124469.1.24753 WP_001124469.1.24763 WP_001124469.1.24783 WP_001124469.1.2479 WP_001124469.1.24791 WP_001124469.1.24799 WP_001124469.1.24870 WP_001124469.1.24876 WP_001124469.1.24899 WP_001124469.1.24929 WP_001124469.1.24939 WP_001124469.1.24946 WP_001124469.1.24960 WP_001124469.1.24968 WP_001124469.1.24981 WP_001124469.1.24982 WP_001124469.1.24984 WP_001124469.1.25019 WP_001124469.1.25038 WP_001124469.1.25039 WP_001124469.1.2504 WP_001124469.1.25042 WP_001124469.1.25050 WP_001124469.1.25060 WP_001124469.1.25076 WP_001124469.1.25082 WP_001124469.1.25085 WP_001124469.1.25086 WP_001124469.1.25087 WP_001124469.1.25088 WP_001124469.1.25126 WP_001124469.1.25141 WP_001124469.1.25183 WP_001124469.1.25201 WP_001124469.1.25203 WP_001124469.1.25289 WP_001124469.1.25305 WP_001124469.1.25312 WP_001124469.1.25324 WP_001124469.1.25346 WP_001124469.1.2537 WP_001124469.1.25378 WP_001124469.1.254 WP_001124469.1.25403 WP_001124469.1.25414 WP_001124469.1.2543 WP_001124469.1.255 WP_001124469.1.25517 WP_001124469.1.25526 WP_001124469.1.25548 WP_001124469.1.25577 WP_001124469.1.2558 WP_001124469.1.25592 WP_001124469.1.25598 WP_001124469.1.25602 WP_001124469.1.25613 WP_001124469.1.25631 WP_001124469.1.25652 WP_001124469.1.25713 WP_001124469.1.25717 WP_001124469.1.25718 WP_001124469.1.25753 WP_001124469.1.25755 WP_001124469.1.25794 WP_001124469.1.25799 WP_001124469.1.25819 WP_001124469.1.25831 WP_001124469.1.25832 WP_001124469.1.25843 WP_001124469.1.25855 WP_001124469.1.2588 WP_001124469.1.25886 WP_001124469.1.2589 WP_001124469.1.25915 WP_001124469.1.2597 WP_001124469.1.25996 WP_001124469.1.26005 WP_001124469.1.26048 WP_001124469.1.26055 WP_001124469.1.26061 WP_001124469.1.26066 WP_001124469.1.26100 WP_001124469.1.26105 WP_001124469.1.2612 WP_001124469.1.26121 WP_001124469.1.26125 WP_001124469.1.26130 WP_001124469.1.26134 WP_001124469.1.26135 WP_001124469.1.26186 WP_001124469.1.26191 WP_001124469.1.26246 WP_001124469.1.26264 WP_001124469.1.26270 WP_001124469.1.26325 WP_001124469.1.26331 WP_001124469.1.2637 WP_001124469.1.26391 WP_001124469.1.26401 WP_001124469.1.2642 WP_001124469.1.26438 WP_001124469.1.26443 WP_001124469.1.26467 WP_001124469.1.26474 WP_001124469.1.26479 WP_001124469.1.26480 WP_001124469.1.26525 WP_001124469.1.26569 WP_001124469.1.26570 WP_001124469.1.26575 WP_001124469.1.26588 WP_001124469.1.26590 WP_001124469.1.26598 WP_001124469.1.26609 WP_001124469.1.26613 WP_001124469.1.26644 WP_001124469.1.26658 WP_001124469.1.26683 WP_001124469.1.26716 WP_001124469.1.26720 WP_001124469.1.26736 WP_001124469.1.26761 WP_001124469.1.26766 WP_001124469.1.26878 WP_001124469.1.26912 WP_001124469.1.2694 WP_001124469.1.26943 WP_001124469.1.26975 WP_001124469.1.26998 WP_001124469.1.27019 WP_001124469.1.27057 WP_001124469.1.27060 WP_001124469.1.27098 WP_001124469.1.27101 WP_001124469.1.27105 WP_001124469.1.2712 WP_001124469.1.27134 WP_001124469.1.27141 WP_001124469.1.27148 WP_001124469.1.27175 WP_001124469.1.27188 WP_001124469.1.27214 WP_001124469.1.27234 WP_001124469.1.27260 WP_001124469.1.27280 WP_001124469.1.27283 WP_001124469.1.27287 WP_001124469.1.27292 WP_001124469.1.2731 WP_001124469.1.27310 WP_001124469.1.27330 WP_001124469.1.27338 WP_001124469.1.27367 WP_001124469.1.27373 WP_001124469.1.27424 WP_001124469.1.27426 WP_001124469.1.27445 WP_001124469.1.27451 WP_001124469.1.27472 WP_001124469.1.27504 WP_001124469.1.27518 WP_001124469.1.27524 WP_001124469.1.27560 WP_001124469.1.27580 WP_001124469.1.27611 WP_001124469.1.27683 WP_001124469.1.27691 WP_001124469.1.27698 WP_001124469.1.27723 WP_001124469.1.27734 WP_001124469.1.27741 WP_001124469.1.27749 WP_001124469.1.27786 WP_001124469.1.27797 WP_001124469.1.27856 WP_001124469.1.27879 WP_001124469.1.27897 WP_001124469.1.27923 WP_001124469.1.27957 WP_001124469.1.27971 WP_001124469.1.28046 WP_001124469.1.28109 WP_001124469.1.2811 WP_001124469.1.28110 WP_001124469.1.28143 WP_001124469.1.28168 WP_001124469.1.2823 WP_001124469.1.28250 WP_001124469.1.2826 WP_001124469.1.28271 WP_001124469.1.28305 WP_001124469.1.28318 WP_001124469.1.28371 WP_001124469.1.28401 WP_001124469.1.28414 WP_001124469.1.28433 WP_001124469.1.28440 WP_001124469.1.28480 WP_001124469.1.28491 WP_001124469.1.28496 WP_001124469.1.28509 WP_001124469.1.28523 WP_001124469.1.28536 WP_001124469.1.28540 WP_001124469.1.28544 WP_001124469.1.28551 WP_001124469.1.28554 WP_001124469.1.28662 WP_001124469.1.28683 WP_001124469.1.28697 WP_001124469.1.28711 WP_001124469.1.28734 WP_001124469.1.28760 WP_001124469.1.28762 WP_001124469.1.28769 WP_001124469.1.28791 WP_001124469.1.28809 WP_001124469.1.28835 WP_001124469.1.28879 WP_001124469.1.28919 WP_001124469.1.28950 WP_001124469.1.28953 WP_001124469.1.28994 WP_001124469.1.29001 WP_001124469.1.29016 WP_001124469.1.29055 WP_001124469.1.29061 WP_001124469.1.29079 WP_001124469.1.29082 WP_001124469.1.291 WP_001124469.1.29118 WP_001124469.1.29126 WP_001124469.1.29128 WP_001124469.1.29146 WP_001124469.1.29150 WP_001124469.1.29164 WP_001124469.1.29176 WP_001124469.1.29194 WP_001124469.1.29197 WP_001124469.1.29202 WP_001124469.1.29206 WP_001124469.1.29221 WP_001124469.1.29230 WP_001124469.1.29239 WP_001124469.1.29252 WP_001124469.1.2931 WP_001124469.1.29404 WP_001124469.1.2942 WP_001124469.1.29443 WP_001124469.1.29495 WP_001124469.1.29503 WP_001124469.1.29504 WP_001124469.1.2952 WP_001124469.1.2954 WP_001124469.1.29556 WP_001124469.1.29564 WP_001124469.1.29590 WP_001124469.1.29597 WP_001124469.1.29603 WP_001124469.1.29618 WP_001124469.1.29643 WP_001124469.1.29669 WP_001124469.1.29683 WP_001124469.1.29689 WP_001124469.1.29699 WP_001124469.1.29715 WP_001124469.1.29724 WP_001124469.1.29740 WP_001124469.1.29746 WP_001124469.1.29752 WP_001124469.1.2978 WP_001124469.1.29798 WP_001124469.1.29812 WP_001124469.1.29818 WP_001124469.1.29840 WP_001124469.1.2986 WP_001124469.1.29876 WP_001124469.1.29933 WP_001124469.1.2995 WP_001124469.1.29967 WP_001124469.1.29976 WP_001124469.1.29992 WP_001124469.1.30 WP_001124469.1.30004 WP_001124469.1.30016 WP_001124469.1.30019 WP_001124469.1.30035 WP_001124469.1.30052 WP_001124469.1.30064 WP_001124469.1.30098 WP_001124469.1.30105 WP_001124469.1.30123 WP_001124469.1.30141 WP_001124469.1.30164 WP_001124469.1.30221 WP_001124469.1.30231 WP_001124469.1.30253 WP_001124469.1.30347 WP_001124469.1.30391 WP_001124469.1.30399 WP_001124469.1.30401 WP_001124469.1.30428 WP_001124469.1.3045 WP_001124469.1.30452 WP_001124469.1.30476 WP_001124469.1.30497 WP_001124469.1.30554 WP_001124469.1.30580 WP_001124469.1.3063 WP_001124469.1.30630 WP_001124469.1.30637 WP_001124469.1.30639 WP_001124469.1.30640 WP_001124469.1.30700 WP_001124469.1.30733 WP_001124469.1.30742 WP_001124469.1.30749 WP_001124469.1.30783 WP_001124469.1.30843 WP_001124469.1.30853 WP_001124469.1.30866 WP_001124469.1.30906 WP_001124469.1.30918 WP_001124469.1.30960 WP_001124469.1.30993 WP_001124469.1.30999 WP_001124469.1.31000 WP_001124469.1.31009 WP_001124469.1.31026 WP_001124469.1.31055 WP_001124469.1.31142 WP_001124469.1.312 WP_001124469.1.31211 WP_001124469.1.31252 WP_001124469.1.31295 WP_001124469.1.31319 WP_001124469.1.31340 WP_001124469.1.31347 WP_001124469.1.31353 WP_001124469.1.31357 WP_001124469.1.31379 WP_001124469.1.3140 WP_001124469.1.31401 WP_001124469.1.31407 WP_001124469.1.31419 WP_001124469.1.31421 WP_001124469.1.31429 WP_001124469.1.31431 WP_001124469.1.31434 WP_001124469.1.31482 WP_001124469.1.31506 WP_001124469.1.31518 WP_001124469.1.31521 WP_001124469.1.31527 WP_001124469.1.31575 WP_001124469.1.31614 WP_001124469.1.31618 WP_001124469.1.31625 WP_001124469.1.31639 WP_001124469.1.31679 WP_001124469.1.31696 WP_001124469.1.31709 WP_001124469.1.31715 WP_001124469.1.31736 WP_001124469.1.31740 WP_001124469.1.3176 WP_001124469.1.31801 WP_001124469.1.31803 WP_001124469.1.3181 WP_001124469.1.31833 WP_001124469.1.31835 WP_001124469.1.31839 WP_001124469.1.31860 WP_001124469.1.31866 WP_001124469.1.31898 WP_001124469.1.31899 WP_001124469.1.31903 WP_001124469.1.31924 WP_001124469.1.3193 WP_001124469.1.31937 WP_001124469.1.31956 WP_001124469.1.31978 WP_001124469.1.3201 WP_001124469.1.32020 WP_001124469.1.32030 WP_001124469.1.32037 WP_001124469.1.32049 WP_001124469.1.32063 WP_001124469.1.32078 WP_001124469.1.32089 WP_001124469.1.32091 WP_001124469.1.32093 WP_001124469.1.32094 WP_001124469.1.3212 WP_001124469.1.32121 WP_001124469.1.32127 WP_001124469.1.32138 WP_001124469.1.32142 WP_001124469.1.32143 WP_001124469.1.3215 WP_001124469.1.32173 WP_001124469.1.32184 WP_001124469.1.322 WP_001124469.1.32222 WP_001124469.1.32232 WP_001124469.1.32234 WP_001124469.1.32236 WP_001124469.1.32242 WP_001124469.1.32243 WP_001124469.1.32279 WP_001124469.1.32287 WP_001124469.1.3233 WP_001124469.1.32333 WP_001124469.1.32394 WP_001124469.1.32406 WP_001124469.1.32435 WP_001124469.1.32443 WP_001124469.1.32448 WP_001124469.1.3247 WP_001124469.1.32475 WP_001124469.1.32479 WP_001124469.1.3248 WP_001124469.1.32536 WP_001124469.1.32561 WP_001124469.1.32574 WP_001124469.1.32580 WP_001124469.1.32590 WP_001124469.1.32591 WP_001124469.1.32635 WP_001124469.1.32655 WP_001124469.1.32661 WP_001124469.1.32680 WP_001124469.1.327 WP_001124469.1.32709 WP_001124469.1.32715 WP_001124469.1.32720 WP_001124469.1.32722 WP_001124469.1.32724 WP_001124469.1.32741 WP_001124469.1.32811 WP_001124469.1.32815 WP_001124469.1.32831 WP_001124469.1.32875 WP_001124469.1.32888 WP_001124469.1.32903 WP_001124469.1.32910 WP_001124469.1.32931 WP_001124469.1.32946 WP_001124469.1.3295 WP_001124469.1.32959 WP_001124469.1.32972 WP_001124469.1.32984 WP_001124469.1.32992 WP_001124469.1.32995 WP_001124469.1.33014 WP_001124469.1.33018 WP_001124469.1.33022 WP_001124469.1.33049 WP_001124469.1.33053 WP_001124469.1.33055 WP_001124469.1.33094 WP_001124469.1.33119 WP_001124469.1.33125 WP_001124469.1.33146 WP_001124469.1.33167 WP_001124469.1.33171 WP_001124469.1.33178 WP_001124469.1.3323 WP_001124469.1.33237 WP_001124469.1.33244 WP_001124469.1.33268 WP_001124469.1.33325 WP_001124469.1.33341 WP_001124469.1.33362 WP_001124469.1.334 WP_001124469.1.33408 WP_001124469.1.33413 WP_001124469.1.33422 WP_001124469.1.33424 WP_001124469.1.33475 WP_001124469.1.33502 WP_001124469.1.33512 WP_001124469.1.33525 WP_001124469.1.3354 WP_001124469.1.33561 WP_001124469.1.33565 WP_001124469.1.33595 WP_001124469.1.33631 WP_001124469.1.33638 WP_001124469.1.33667 WP_001124469.1.33680 WP_001124469.1.33729 WP_001124469.1.33745 WP_001124469.1.33746 WP_001124469.1.33751 WP_001124469.1.33780 WP_001124469.1.33799 WP_001124469.1.33823 WP_001124469.1.33853 WP_001124469.1.33854 WP_001124469.1.33905 WP_001124469.1.33914 WP_001124469.1.33948 WP_001124469.1.33952 WP_001124469.1.33974 WP_001124469.1.33979 WP_001124469.1.3398 WP_001124469.1.33981 WP_001124469.1.34003 WP_001124469.1.3401 WP_001124469.1.34094 WP_001124469.1.3411 WP_001124469.1.34122 WP_001124469.1.34124 WP_001124469.1.3415 WP_001124469.1.34206 WP_001124469.1.34224 WP_001124469.1.34269 WP_001124469.1.34270 WP_001124469.1.34273 WP_001124469.1.34363 WP_001124469.1.34380 WP_001124469.1.34383 WP_001124469.1.34397 WP_001124469.1.3444 WP_001124469.1.34440 WP_001124469.1.34464 WP_001124469.1.34500 WP_001124469.1.34525 WP_001124469.1.34532 WP_001124469.1.34538 WP_001124469.1.34541 WP_001124469.1.34557 WP_001124469.1.34605 WP_001124469.1.34655 WP_001124469.1.34668 WP_001124469.1.34680 WP_001124469.1.34682 WP_001124469.1.34686 WP_001124469.1.347 WP_001124469.1.34727 WP_001124469.1.34781 WP_001124469.1.34782 WP_001124469.1.34794 WP_001124469.1.34827 WP_001124469.1.34855 WP_001124469.1.34948 WP_001124469.1.34982 WP_001124469.1.34983 WP_001124469.1.34990 WP_001124469.1.34993 WP_001124469.1.35006 WP_001124469.1.35039 WP_001124469.1.35114 WP_001124469.1.35180 WP_001124469.1.35186 WP_001124469.1.35202 WP_001124469.1.35204 WP_001124469.1.3521 WP_001124469.1.35211 WP_001124469.1.35316 WP_001124469.1.35360 WP_001124469.1.35365 WP_001124469.1.35368 WP_001124469.1.35376 WP_001124469.1.3539 WP_001124469.1.35393 WP_001124469.1.35398 WP_001124469.1.35464 WP_001124469.1.35465 WP_001124469.1.35468 WP_001124469.1.3550 WP_001124469.1.35552 WP_001124469.1.3560 WP_001124469.1.35604 WP_001124469.1.35649 WP_001124469.1.35653 WP_001124469.1.35654 WP_001124469.1.35698 WP_001124469.1.35704 WP_001124469.1.35724 WP_001124469.1.35740 WP_001124469.1.35922 WP_001124469.1.35927 WP_001124469.1.35934 WP_001124469.1.35942 WP_001124469.1.3598 WP_001124469.1.35983 WP_001124469.1.36010 WP_001124469.1.36040 WP_001124469.1.36042 WP_001124469.1.36070 WP_001124469.1.36071 WP_001124469.1.36094 WP_001124469.1.36129 WP_001124469.1.36159 WP_001124469.1.36164 WP_001124469.1.36166 WP_001124469.1.36177 WP_001124469.1.36182 WP_001124469.1.36207 WP_001124469.1.36212 WP_001124469.1.36281 WP_001124469.1.36299 WP_001124469.1.36334 WP_001124469.1.36386 WP_001124469.1.36393 WP_001124469.1.36426 WP_001124469.1.36496 WP_001124469.1.36500 WP_001124469.1.36507 WP_001124469.1.36523 WP_001124469.1.36531 WP_001124469.1.36537 WP_001124469.1.36610 WP_001124469.1.36626 WP_001124469.1.36627 WP_001124469.1.36628 WP_001124469.1.36699 WP_001124469.1.36707 WP_001124469.1.36724 WP_001124469.1.36739 WP_001124469.1.36746 WP_001124469.1.36767 WP_001124469.1.36806 WP_001124469.1.36812 WP_001124469.1.36817 WP_001124469.1.36826 WP_001124469.1.36833 WP_001124469.1.36925 WP_001124469.1.36971 WP_001124469.1.36975 WP_001124469.1.37006 WP_001124469.1.37020 WP_001124469.1.37046 WP_001124469.1.37057 WP_001124469.1.37076 WP_001124469.1.37099 WP_001124469.1.37101 WP_001124469.1.37102 WP_001124469.1.37122 WP_001124469.1.37146 WP_001124469.1.37155 WP_001124469.1.37206 WP_001124469.1.3723 WP_001124469.1.37233 WP_001124469.1.37252 WP_001124469.1.37261 WP_001124469.1.3730 WP_001124469.1.37329 WP_001124469.1.37334 WP_001124469.1.37337 WP_001124469.1.37352 WP_001124469.1.37371 WP_001124469.1.37372 WP_001124469.1.37419 WP_001124469.1.37433 WP_001124469.1.37445 WP_001124469.1.37476 WP_001124469.1.37485 WP_001124469.1.3749 WP_001124469.1.37510 WP_001124469.1.37538 WP_001124469.1.37543 WP_001124469.1.37548 WP_001124469.1.37549 WP_001124469.1.37554 WP_001124469.1.37576 WP_001124469.1.37588 WP_001124469.1.3762 WP_001124469.1.37634 WP_001124469.1.37637 WP_001124469.1.377 WP_001124469.1.3772 WP_001124469.1.37730 WP_001124469.1.37731 WP_001124469.1.37745 WP_001124469.1.37750 WP_001124469.1.37758 WP_001124469.1.37762 WP_001124469.1.37766 WP_001124469.1.37769 WP_001124469.1.37773 WP_001124469.1.37830 WP_001124469.1.37847 WP_001124469.1.37852 WP_001124469.1.37880 WP_001124469.1.37887 WP_001124469.1.37897 WP_001124469.1.37917 WP_001124469.1.37926 WP_001124469.1.37940 WP_001124469.1.3795 WP_001124469.1.37964 WP_001124469.1.37967 WP_001124469.1.37995 WP_001124469.1.38033 WP_001124469.1.38050 WP_001124469.1.38063 WP_001124469.1.38081 WP_001124469.1.38085 WP_001124469.1.38103 WP_001124469.1.38105 WP_001124469.1.38107 WP_001124469.1.3811 WP_001124469.1.38119 WP_001124469.1.38120 WP_001124469.1.38155 WP_001124469.1.38162 WP_001124469.1.38182 WP_001124469.1.38185 WP_001124469.1.38202 WP_001124469.1.3822 WP_001124469.1.38257 WP_001124469.1.38264 WP_001124469.1.38306 WP_001124469.1.38314 WP_001124469.1.38323 WP_001124469.1.38357 WP_001124469.1.38363 WP_001124469.1.38369 WP_001124469.1.38371 WP_001124469.1.38412 WP_001124469.1.38419 WP_001124469.1.38533 WP_001124469.1.38544 WP_001124469.1.38584 WP_001124469.1.38610 WP_001124469.1.38626 WP_001124469.1.38629 WP_001124469.1.38636 WP_001124469.1.38694 WP_001124469.1.38722 WP_001124469.1.3873 WP_001124469.1.38751 WP_001124469.1.38777 WP_001124469.1.38811 WP_001124469.1.38827 WP_001124469.1.38835 WP_001124469.1.38843 WP_001124469.1.38896 WP_001124469.1.389 WP_001124469.1.38920 WP_001124469.1.38935 WP_001124469.1.38950 WP_001124469.1.38956 WP_001124469.1.38958 WP_001124469.1.39005 WP_001124469.1.39015 WP_001124469.1.3903 WP_001124469.1.39037 WP_001124469.1.3904 WP_001124469.1.39042 WP_001124469.1.39063 WP_001124469.1.39103 WP_001124469.1.39111 WP_001124469.1.39123 WP_001124469.1.39150 WP_001124469.1.39155 WP_001124469.1.39157 WP_001124469.1.39164 WP_001124469.1.39167 WP_001124469.1.39171 WP_001124469.1.39180 WP_001124469.1.3921 WP_001124469.1.39249 WP_001124469.1.39268 WP_001124469.1.39286 WP_001124469.1.39302 WP_001124469.1.39305 WP_001124469.1.39310 WP_001124469.1.39342 WP_001124469.1.39356 WP_001124469.1.39358 WP_001124469.1.39365 WP_001124469.1.39367 WP_001124469.1.39373 WP_001124469.1.39415 WP_001124469.1.39430 WP_001124469.1.39468 WP_001124469.1.39481 WP_001124469.1.39509 WP_001124469.1.3954 WP_001124469.1.39541 WP_001124469.1.39564 WP_001124469.1.39580 WP_001124469.1.39594 WP_001124469.1.39601 WP_001124469.1.39606 WP_001124469.1.39636 WP_001124469.1.39646 WP_001124469.1.39690 WP_001124469.1.3970 WP_001124469.1.39715 WP_001124469.1.39730 WP_001124469.1.39758 WP_001124469.1.39780 WP_001124469.1.39820 WP_001124469.1.39822 WP_001124469.1.39829 WP_001124469.1.39870 WP_001124469.1.39938 WP_001124469.1.39961 WP_001124469.1.39970 WP_001124469.1.40016 WP_001124469.1.40088 WP_001124469.1.40113 WP_001124469.1.40121 WP_001124469.1.40147 WP_001124469.1.40159 WP_001124469.1.40183 WP_001124469.1.40192 WP_001124469.1.4020 WP_001124469.1.40206 WP_001124469.1.40212 WP_001124469.1.40218 WP_001124469.1.40234 WP_001124469.1.40238 WP_001124469.1.40249 WP_001124469.1.40298 WP_001124469.1.4030 WP_001124469.1.40315 WP_001124469.1.40317 WP_001124469.1.40319 WP_001124469.1.40335 WP_001124469.1.40382 WP_001124469.1.40389 WP_001124469.1.40391 WP_001124469.1.40403 WP_001124469.1.40445 WP_001124469.1.4049 WP_001124469.1.40499 WP_001124469.1.40502 WP_001124469.1.40509 WP_001124469.1.40524 WP_001124469.1.40548 WP_001124469.1.40549 WP_001124469.1.40563 WP_001124469.1.40596 WP_001124469.1.40599 WP_001124469.1.406 WP_001124469.1.40617 WP_001124469.1.40623 WP_001124469.1.40629 WP_001124469.1.40668 WP_001124469.1.40686 WP_001124469.1.40742 WP_001124469.1.40758 WP_001124469.1.40781 WP_001124469.1.40793 WP_001124469.1.4081 WP_001124469.1.40815 WP_001124469.1.4082 WP_001124469.1.40842 WP_001124469.1.40865 WP_001124469.1.40882 WP_001124469.1.40898 WP_001124469.1.40900 WP_001124469.1.40912 WP_001124469.1.40937 WP_001124469.1.40952 WP_001124469.1.40965 WP_001124469.1.4103 WP_001124469.1.41037 WP_001124469.1.41045 WP_001124469.1.41060 WP_001124469.1.41125 WP_001124469.1.41147 WP_001124469.1.41206 WP_001124469.1.41230 WP_001124469.1.41239 WP_001124469.1.41244 WP_001124469.1.41259 WP_001124469.1.4126 WP_001124469.1.41263 WP_001124469.1.41271 WP_001124469.1.41287 WP_001124469.1.41294 WP_001124469.1.41315 WP_001124469.1.41330 WP_001124469.1.41339 WP_001124469.1.41346 WP_001124469.1.41363 WP_001124469.1.41371 WP_001124469.1.41372 WP_001124469.1.41391 WP_001124469.1.41392 WP_001124469.1.41402 WP_001124469.1.41417 WP_001124469.1.4142 WP_001124469.1.41436 WP_001124469.1.41449 WP_001124469.1.41455 WP_001124469.1.41457 WP_001124469.1.41466 WP_001124469.1.41478 WP_001124469.1.41479 WP_001124469.1.41481 WP_001124469.1.41484 WP_001124469.1.41488 WP_001124469.1.41513 WP_001124469.1.41530 WP_001124469.1.41536 WP_001124469.1.41539 WP_001124469.1.41556 WP_001124469.1.41566 WP_001124469.1.41606 WP_001124469.1.41613 WP_001124469.1.41651 WP_001124469.1.41654 WP_001124469.1.41712 WP_001124469.1.41718 WP_001124469.1.4172 WP_001124469.1.41734 WP_001124469.1.41740 WP_001124469.1.41752 WP_001124469.1.41778 WP_001124469.1.41780 WP_001124469.1.41782 WP_001124469.1.41784 WP_001124469.1.41812 WP_001124469.1.41813 WP_001124469.1.41826 WP_001124469.1.41849 WP_001124469.1.41900 WP_001124469.1.41960 WP_001124469.1.41964 WP_001124469.1.41988 WP_001124469.1.42022 WP_001124469.1.42027 WP_001124469.1.42033 WP_001124469.1.42036 WP_001124469.1.42038 WP_001124469.1.42060 WP_001124469.1.42095 WP_001124469.1.42096 WP_001124469.1.4213 WP_001124469.1.42138 WP_001124469.1.4214 WP_001124469.1.42159 WP_001124469.1.42179 WP_001124469.1.42203 WP_001124469.1.42209 WP_001124469.1.42226 WP_001124469.1.4224 WP_001124469.1.42252 WP_001124469.1.42277 WP_001124469.1.42284 WP_001124469.1.42300 WP_001124469.1.42359 WP_001124469.1.42367 WP_001124469.1.42369 WP_001124469.1.42376 WP_001124469.1.42387 WP_001124469.1.42415 WP_001124469.1.4242 WP_001124469.1.42432 WP_001124469.1.42442 WP_001124469.1.42447 WP_001124469.1.42448 WP_001124469.1.42456 WP_001124469.1.42480 WP_001124469.1.4250 WP_001124469.1.42513 WP_001124469.1.42522 WP_001124469.1.42594 WP_001124469.1.4261 WP_001124469.1.42632 WP_001124469.1.42661 WP_001124469.1.42669 WP_001124469.1.42728 WP_001124469.1.42748 WP_001124469.1.42749 WP_001124469.1.42750 WP_001124469.1.42761 WP_001124469.1.42770 WP_001124469.1.42791 WP_001124469.1.42813 WP_001124469.1.4282 WP_001124469.1.42828 WP_001124469.1.42830 WP_001124469.1.42832 WP_001124469.1.42863 WP_001124469.1.42879 WP_001124469.1.42891 WP_001124469.1.42918 WP_001124469.1.42936 WP_001124469.1.42937 WP_001124469.1.42950 WP_001124469.1.42962 WP_001124469.1.42966 WP_001124469.1.42975 WP_001124469.1.42987 WP_001124469.1.42989 WP_001124469.1.43013 WP_001124469.1.43035 WP_001124469.1.4306 WP_001124469.1.43079 WP_001124469.1.43121 WP_001124469.1.4313 WP_001124469.1.43132 WP_001124469.1.43133 WP_001124469.1.43137 WP_001124469.1.43140 WP_001124469.1.43166 WP_001124469.1.43174 WP_001124469.1.43177 WP_001124469.1.43196 WP_001124469.1.43270 WP_001124469.1.43316 WP_001124469.1.43324 WP_001124469.1.43363 WP_001124469.1.43374 WP_001124469.1.43384 WP_001124469.1.43389 WP_001124469.1.4342 WP_001124469.1.43444 WP_001124469.1.43448 WP_001124469.1.43455 WP_001124469.1.43469 WP_001124469.1.43473 WP_001124469.1.43489 WP_001124469.1.43536 WP_001124469.1.43561 WP_001124469.1.43566 WP_001124469.1.43604 WP_001124469.1.43622 WP_001124469.1.43642 WP_001124469.1.43750 WP_001124469.1.43754 WP_001124469.1.43769 WP_001124469.1.43798 WP_001124469.1.43804 WP_001124469.1.43816 WP_001124469.1.43837 WP_001124469.1.43858 WP_001124469.1.43898 WP_001124469.1.43911 WP_001124469.1.43925 WP_001124469.1.43939 WP_001124469.1.43989 WP_001124469.1.4400 WP_001124469.1.44018 WP_001124469.1.44020 WP_001124469.1.44029 WP_001124469.1.44040 WP_001124469.1.44075 WP_001124469.1.44077 WP_001124469.1.44088 WP_001124469.1.44096 WP_001124469.1.44100 WP_001124469.1.4411 WP_001124469.1.44115 WP_001124469.1.44125 WP_001124469.1.44130 WP_001124469.1.4415 WP_001124469.1.44162 WP_001124469.1.44165 WP_001124469.1.44166 WP_001124469.1.44203 WP_001124469.1.44211 WP_001124469.1.44222 WP_001124469.1.44238 WP_001124469.1.44264 WP_001124469.1.44287 WP_001124469.1.44292 WP_001124469.1.44314 WP_001124469.1.44365 WP_001124469.1.44389 WP_001124469.1.44424 WP_001124469.1.44426 WP_001124469.1.44445 WP_001124469.1.4445 WP_001124469.1.44452 WP_001124469.1.44458 WP_001124469.1.44461 WP_001124469.1.44488 WP_001124469.1.4449 WP_001124469.1.44539 WP_001124469.1.44561 WP_001124469.1.44570 WP_001124469.1.44587 WP_001124469.1.44608 WP_001124469.1.44627 WP_001124469.1.44661 WP_001124469.1.44671 WP_001124469.1.44686 WP_001124469.1.44724 WP_001124469.1.44733 WP_001124469.1.44756 WP_001124469.1.44759 WP_001124469.1.44784 WP_001124469.1.448 WP_001124469.1.44814 WP_001124469.1.44818 WP_001124469.1.44821 WP_001124469.1.44840 WP_001124469.1.44848 WP_001124469.1.44849 WP_001124469.1.44854 WP_001124469.1.44857 WP_001124469.1.44906 WP_001124469.1.44923 WP_001124469.1.44954 WP_001124469.1.44960 WP_001124469.1.44961 WP_001124469.1.44970 WP_001124469.1.44980 WP_001124469.1.45000 WP_001124469.1.45020 WP_001124469.1.45025 WP_001124469.1.45028 WP_001124469.1.45043 WP_001124469.1.45053 WP_001124469.1.45068 WP_001124469.1.45076 WP_001124469.1.45104 WP_001124469.1.45116 WP_001124469.1.45153 WP_001124469.1.45156 WP_001124469.1.4516 WP_001124469.1.45195 WP_001124469.1.45208 WP_001124469.1.4524 WP_001124469.1.45246 WP_001124469.1.45293 WP_001124469.1.45301 WP_001124469.1.45313 WP_001124469.1.45329 WP_001124469.1.4535 WP_001124469.1.45359 WP_001124469.1.45392 WP_001124469.1.45404 WP_001124469.1.45440 WP_001124469.1.45444 WP_001124469.1.4549 WP_001124469.1.45494 WP_001124469.1.45500 WP_001124469.1.45538 WP_001124469.1.45565 WP_001124469.1.45575 WP_001124469.1.45581 WP_001124469.1.45595 WP_001124469.1.45600 WP_001124469.1.4563 WP_001124469.1.45664 WP_001124469.1.4570 WP_001124469.1.45707 WP_001124469.1.45718 WP_001124469.1.4574 WP_001124469.1.45741 WP_001124469.1.45752 WP_001124469.1.45799 WP_001124469.1.45841 WP_001124469.1.45846 WP_001124469.1.45865 WP_001124469.1.45868 WP_001124469.1.45901 WP_001124469.1.4593 WP_001124469.1.45930 WP_001124469.1.45933 WP_001124469.1.45941 WP_001124469.1.45949 WP_001124469.1.45960 WP_001124469.1.45962 WP_001124469.1.45968 WP_001124469.1.45991 WP_001124469.1.4600 WP_001124469.1.46027 WP_001124469.1.46039 WP_001124469.1.46048 WP_001124469.1.46049 WP_001124469.1.46070 WP_001124469.1.46081 WP_001124469.1.46097 WP_001124469.1.46105 WP_001124469.1.46115 WP_001124469.1.4613 WP_001124469.1.4617 WP_001124469.1.46186 WP_001124469.1.4619 WP_001124469.1.46197 WP_001124469.1.46213 WP_001124469.1.46239 WP_001124469.1.46245 WP_001124469.1.46257 WP_001124469.1.46282 WP_001124469.1.46283 WP_001124469.1.46301 WP_001124469.1.46325 WP_001124469.1.46329 WP_001124469.1.46369 WP_001124469.1.46414 WP_001124469.1.46429 WP_001124469.1.4643 WP_001124469.1.46441 WP_001124469.1.46451 WP_001124469.1.4646 WP_001124469.1.46468 WP_001124469.1.4647 WP_001124469.1.46477 WP_001124469.1.46503 WP_001124469.1.46526 WP_001124469.1.46541 WP_001124469.1.46552 WP_001124469.1.46555 WP_001124469.1.4657 WP_001124469.1.46573 WP_001124469.1.46582 WP_001124469.1.46594 WP_001124469.1.46597 WP_001124469.1.46602 WP_001124469.1.46611 WP_001124469.1.46614 WP_001124469.1.46616 WP_001124469.1.46626 WP_001124469.1.46643 WP_001124469.1.46655 WP_001124469.1.46668 WP_001124469.1.46734 WP_001124469.1.46743 WP_001124469.1.46802 WP_001124469.1.46810 WP_001124469.1.46821 WP_001124469.1.46832 WP_001124469.1.46857 WP_001124469.1.46860 WP_001124469.1.46876 WP_001124469.1.46882 WP_001124469.1.46898 WP_001124469.1.46909 WP_001124469.1.4691 WP_001124469.1.46912 WP_001124469.1.46913 WP_001124469.1.46990 WP_001124469.1.46991 WP_001124469.1.46994 WP_001124469.1.46999 WP_001124469.1.47028 WP_001124469.1.47029 WP_001124469.1.47030 WP_001124469.1.47034 WP_001124469.1.47038 WP_001124469.1.47048 WP_001124469.1.47050 WP_001124469.1.47069 WP_001124469.1.4708 WP_001124469.1.47135 WP_001124469.1.47140 WP_001124469.1.47156 WP_001124469.1.47171 WP_001124469.1.47186 WP_001124469.1.47197 WP_001124469.1.47198 WP_001124469.1.4723 WP_001124469.1.47246 WP_001124469.1.47280 WP_001124469.1.47307 WP_001124469.1.47316 WP_001124469.1.47319 WP_001124469.1.47322 WP_001124469.1.47332 WP_001124469.1.47344 WP_001124469.1.47350 WP_001124469.1.47356 WP_001124469.1.47363 WP_001124469.1.47370 WP_001124469.1.47398 WP_001124469.1.4740 WP_001124469.1.47401 WP_001124469.1.47411 WP_001124469.1.47414 WP_001124469.1.47416 WP_001124469.1.47425 WP_001124469.1.47451 WP_001124469.1.47473 WP_001124469.1.47477 WP_001124469.1.47496 WP_001124469.1.47529 WP_001124469.1.47533 WP_001124469.1.47555 WP_001124469.1.47582 WP_001124469.1.47634 WP_001124469.1.47654 WP_001124469.1.47662 WP_001124469.1.47673 WP_001124469.1.4772 WP_001124469.1.4773 WP_001124469.1.47734 WP_001124469.1.47740 WP_001124469.1.47744 WP_001124469.1.47761 WP_001124469.1.47764 WP_001124469.1.47765 WP_001124469.1.47770 WP_001124469.1.47775 WP_001124469.1.47784 WP_001124469.1.47791 WP_001124469.1.47820 WP_001124469.1.47827 WP_001124469.1.47848 WP_001124469.1.4785 WP_001124469.1.47884 WP_001124469.1.47914 WP_001124469.1.47954 WP_001124469.1.4796 WP_001124469.1.47962 WP_001124469.1.47976 WP_001124469.1.47981 WP_001124469.1.47983 WP_001124469.1.47994 WP_001124469.1.48000 WP_001124469.1.48018 WP_001124469.1.48048 WP_001124469.1.48065 WP_001124469.1.48073 WP_001124469.1.48077 WP_001124469.1.48087 WP_001124469.1.48096 WP_001124469.1.48111 WP_001124469.1.4812 WP_001124469.1.48144 WP_001124469.1.48176 WP_001124469.1.48188 WP_001124469.1.48194 WP_001124469.1.48200 WP_001124469.1.48222 WP_001124469.1.48226 WP_001124469.1.48258 WP_001124469.1.48285 WP_001124469.1.48290 WP_001124469.1.48291 WP_001124469.1.48355 WP_001124469.1.48371 WP_001124469.1.48385 WP_001124469.1.48404 WP_001124469.1.48417 WP_001124469.1.48421 WP_001124469.1.48433 WP_001124469.1.48477 WP_001124469.1.48480 WP_001124469.1.48483 WP_001124469.1.48505 WP_001124469.1.48522 WP_001124469.1.4857 WP_001124469.1.48571 WP_001124469.1.48590 WP_001124469.1.486 WP_001124469.1.48602 WP_001124469.1.48615 WP_001124469.1.48678 WP_001124469.1.48697 WP_001124469.1.4871 WP_001124469.1.48712 WP_001124469.1.48771 WP_001124469.1.48792 WP_001124469.1.48801 WP_001124469.1.48806 WP_001124469.1.48825 WP_001124469.1.48847 WP_001124469.1.48860 WP_001124469.1.48901 WP_001124469.1.48907 WP_001124469.1.48910 WP_001124469.1.48921 WP_001124469.1.48928 WP_001124469.1.48953 WP_001124469.1.48954 WP_001124469.1.48970 WP_001124469.1.48974 WP_001124469.1.49009 WP_001124469.1.49104 WP_001124469.1.49107 WP_001124469.1.49124 WP_001124469.1.49136 WP_001124469.1.49147 WP_001124469.1.49229 WP_001124469.1.49236 WP_001124469.1.49243 WP_001124469.1.49259 WP_001124469.1.49275 WP_001124469.1.4931 WP_001124469.1.49332 WP_001124469.1.49336 WP_001124469.1.49401 WP_001124469.1.49431 WP_001124469.1.49459 WP_001124469.1.49464 WP_001124469.1.49481 WP_001124469.1.49482 WP_001124469.1.4949 WP_001124469.1.49496 WP_001124469.1.49528 WP_001124469.1.4953 WP_001124469.1.49531 WP_001124469.1.49537 WP_001124469.1.49546 WP_001124469.1.49558 WP_001124469.1.49567 WP_001124469.1.49599 WP_001124469.1.49645 WP_001124469.1.49655 WP_001124469.1.49661 WP_001124469.1.49684 WP_001124469.1.497 WP_001124469.1.49712 WP_001124469.1.49722 WP_001124469.1.49733 WP_001124469.1.49747 WP_001124469.1.49768 WP_001124469.1.49771 WP_001124469.1.49774 WP_001124469.1.49777 WP_001124469.1.49788 WP_001124469.1.49823 WP_001124469.1.49856 WP_001124469.1.49861 WP_001124469.1.49879 WP_001124469.1.49900 WP_001124469.1.49902 WP_001124469.1.49950 WP_001124469.1.49954 WP_001124469.1.49987 WP_001124469.1.50006 WP_001124469.1.50008 WP_001124469.1.5003 WP_001124469.1.50036 WP_001124469.1.50078 WP_001124469.1.50098 WP_001124469.1.50110 WP_001124469.1.50113 WP_001124469.1.50119 WP_001124469.1.50136 WP_001124469.1.5017 WP_001124469.1.50182 WP_001124469.1.50191 WP_001124469.1.50196 WP_001124469.1.50207 WP_001124469.1.50230 WP_001124469.1.50258 WP_001124469.1.50266 WP_001124469.1.50269 WP_001124469.1.50273 WP_001124469.1.50278 WP_001124469.1.50329 WP_001124469.1.50345 WP_001124469.1.50353 WP_001124469.1.50358 WP_001124469.1.50361 WP_001124469.1.50366 WP_001124469.1.5037 WP_001124469.1.50380 WP_001124469.1.50381 WP_001124469.1.5040 WP_001124469.1.5041 WP_001124469.1.50412 WP_001124469.1.50418 WP_001124469.1.50446 WP_001124469.1.50452 WP_001124469.1.5046 WP_001124469.1.50539 WP_001124469.1.50548 WP_001124469.1.50549 WP_001124469.1.50564 WP_001124469.1.50586 WP_001124469.1.506 WP_001124469.1.5061 WP_001124469.1.50616 WP_001124469.1.5064 WP_001124469.1.5067 WP_001124469.1.50715 WP_001124469.1.50717 WP_001124469.1.50725 WP_001124469.1.50762 WP_001124469.1.50936 WP_001124469.1.50939 WP_001124469.1.50947 WP_001124469.1.50957 WP_001124469.1.50969 WP_001124469.1.50986 WP_001124469.1.50993 WP_001124469.1.50996 WP_001124469.1.51013 WP_001124469.1.51042 WP_001124469.1.51058 WP_001124469.1.5106 WP_001124469.1.51109 WP_001124469.1.51127 WP_001124469.1.51154 WP_001124469.1.51171 WP_001124469.1.51172 WP_001124469.1.51175 WP_001124469.1.51201 WP_001124469.1.51206 WP_001124469.1.51248 WP_001124469.1.51255 WP_001124469.1.51260 WP_001124469.1.51278 WP_001124469.1.5128 WP_001124469.1.51299 WP_001124469.1.51307 WP_001124469.1.51320 WP_001124469.1.51323 WP_001124469.1.51325 WP_001124469.1.51336 WP_001124469.1.51354 WP_001124469.1.51364 WP_001124469.1.51380 WP_001124469.1.51405 WP_001124469.1.51427 WP_001124469.1.51430 WP_001124469.1.51441 WP_001124469.1.5146 WP_001124469.1.51462 WP_001124469.1.51482 WP_001124469.1.51490 WP_001124469.1.51495 WP_001124469.1.51503 WP_001124469.1.51505 WP_001124469.1.51513 WP_001124469.1.51525 WP_001124469.1.51537 WP_001124469.1.51539 WP_001124469.1.51542 WP_001124469.1.51548 WP_001124469.1.51552 WP_001124469.1.5157 WP_001124469.1.51580 WP_001124469.1.51587 WP_001124469.1.51600 WP_001124469.1.51607 WP_001124469.1.51624 WP_001124469.1.51629 WP_001124469.1.51643 WP_001124469.1.51662 WP_001124469.1.51690 WP_001124469.1.51693 WP_001124469.1.51718 WP_001124469.1.5172 WP_001124469.1.51736 WP_001124469.1.51784 WP_001124469.1.51834 WP_001124469.1.51837 WP_001124469.1.51839 WP_001124469.1.51869 WP_001124469.1.51881 WP_001124469.1.51899 WP_001124469.1.51906 WP_001124469.1.51968 WP_001124469.1.51985 WP_001124469.1.51988 WP_001124469.1.51999 WP_001124469.1.52002 WP_001124469.1.52011 WP_001124469.1.52020 WP_001124469.1.52039 WP_001124469.1.52044 WP_001124469.1.52062 WP_001124469.1.52076 WP_001124469.1.52111 WP_001124469.1.52126 WP_001124469.1.52127 WP_001124469.1.52135 WP_001124469.1.5217 WP_001124469.1.52171 WP_001124469.1.52186 WP_001124469.1.52200 WP_001124469.1.52211 WP_001124469.1.52214 WP_001124469.1.52225 WP_001124469.1.52230 WP_001124469.1.52236 WP_001124469.1.52240 WP_001124469.1.52243 WP_001124469.1.52249 WP_001124469.1.5227 WP_001124469.1.52272 WP_001124469.1.52304 WP_001124469.1.52305 WP_001124469.1.52324 WP_001124469.1.52328 WP_001124469.1.52333 WP_001124469.1.52378 WP_001124469.1.5239 WP_001124469.1.52406 WP_001124469.1.52413 WP_001124469.1.52419 WP_001124469.1.52421 WP_001124469.1.52492 WP_001124469.1.52496 WP_001124469.1.52524 WP_001124469.1.52543 WP_001124469.1.52554 WP_001124469.1.52558 WP_001124469.1.52567 WP_001124469.1.52601 WP_001124469.1.52612 WP_001124469.1.5265 WP_001124469.1.52662 WP_001124469.1.52691 WP_001124469.1.52704 WP_001124469.1.52710 WP_001124469.1.5272 WP_001124469.1.52735 WP_001124469.1.52755 WP_001124469.1.52762 WP_001124469.1.52774 WP_001124469.1.52777 WP_001124469.1.52780 WP_001124469.1.52801 WP_001124469.1.52844 WP_001124469.1.52846 WP_001124469.1.52853 WP_001124469.1.52881 WP_001124469.1.52883 WP_001124469.1.52895 WP_001124469.1.52908 WP_001124469.1.5291 WP_001124469.1.52913 WP_001124469.1.52933 WP_001124469.1.52942 WP_001124469.1.52945 WP_001124469.1.52962 WP_001124469.1.52995 WP_001124469.1.52996 WP_001124469.1.53012 WP_001124469.1.53020 WP_001124469.1.53027 WP_001124469.1.53065 WP_001124469.1.53084 WP_001124469.1.53099 WP_001124469.1.5310 WP_001124469.1.53110 WP_001124469.1.53155 WP_001124469.1.53181 WP_001124469.1.53186 WP_001124469.1.532 WP_001124469.1.53211 WP_001124469.1.5322 WP_001124469.1.53223 WP_001124469.1.53228 WP_001124469.1.53238 WP_001124469.1.53242 WP_001124469.1.53251 WP_001124469.1.53252 WP_001124469.1.53262 WP_001124469.1.53270 WP_001124469.1.53277 WP_001124469.1.53308 WP_001124469.1.53327 WP_001124469.1.53356 WP_001124469.1.53364 WP_001124469.1.53377 WP_001124469.1.53401 WP_001124469.1.53419 WP_001124469.1.5342 WP_001124469.1.53428 WP_001124469.1.53431 WP_001124469.1.53482 WP_001124469.1.53505 WP_001124469.1.5351 WP_001124469.1.53535 WP_001124469.1.53537 WP_001124469.1.53545 WP_001124469.1.53556 WP_001124469.1.53574 WP_001124469.1.53582 WP_001124469.1.53590 WP_001124469.1.53592 WP_001124469.1.53594 WP_001124469.1.5362 WP_001124469.1.53642 WP_001124469.1.53693 WP_001124469.1.53706 WP_001124469.1.53769 WP_001124469.1.53809 WP_001124469.1.53810 WP_001124469.1.53811 WP_001124469.1.53841 WP_001124469.1.53863 WP_001124469.1.53866 WP_001124469.1.53878 WP_001124469.1.53884 WP_001124469.1.5393 WP_001124469.1.53931 WP_001124469.1.5395 WP_001124469.1.53966 WP_001124469.1.53968 WP_001124469.1.53972 WP_001124469.1.53978 WP_001124469.1.53994 WP_001124469.1.54002 WP_001124469.1.54013 WP_001124469.1.54023 WP_001124469.1.54024 WP_001124469.1.54032 WP_001124469.1.54072 WP_001124469.1.54091 WP_001124469.1.54144 WP_001124469.1.54169 WP_001124469.1.54185 WP_001124469.1.54202 WP_001124469.1.54213 WP_001124469.1.54307 WP_001124469.1.54317 WP_001124469.1.54329 WP_001124469.1.5433 WP_001124469.1.54359 WP_001124469.1.5440 WP_001124469.1.5441 WP_001124469.1.54454 WP_001124469.1.54463 WP_001124469.1.54476 WP_001124469.1.54507 WP_001124469.1.54546 WP_001124469.1.54585 WP_001124469.1.54591 WP_001124469.1.5460 WP_001124469.1.54602 WP_001124469.1.54605 WP_001124469.1.54614 WP_001124469.1.54617 WP_001124469.1.54620 WP_001124469.1.54625 WP_001124469.1.54638 WP_001124469.1.54641 WP_001124469.1.5467 WP_001124469.1.54688 WP_001124469.1.54695 WP_001124469.1.5470 WP_001124469.1.54708 WP_001124469.1.54725 WP_001124469.1.54729 WP_001124469.1.54755 WP_001124469.1.5479 WP_001124469.1.54798 WP_001124469.1.54817 WP_001124469.1.54829 WP_001124469.1.5486 WP_001124469.1.54883 WP_001124469.1.54918 WP_001124469.1.54921 WP_001124469.1.54941 WP_001124469.1.54946 WP_001124469.1.54981 WP_001124469.1.54989 WP_001124469.1.54991 WP_001124469.1.54993 WP_001124469.1.55003 WP_001124469.1.55005 WP_001124469.1.55041 WP_001124469.1.55070 WP_001124469.1.55112 WP_001124469.1.55115 WP_001124469.1.55123 WP_001124469.1.55134 WP_001124469.1.55144 WP_001124469.1.55177 WP_001124469.1.55185 WP_001124469.1.55197 WP_001124469.1.5520 WP_001124469.1.55203 WP_001124469.1.55218 WP_001124469.1.55222 WP_001124469.1.55226 WP_001124469.1.55286 WP_001124469.1.55291 WP_001124469.1.55338 WP_001124469.1.55342 WP_001124469.1.55357 WP_001124469.1.55381 WP_001124469.1.55417 WP_001124469.1.55424 WP_001124469.1.55425 WP_001124469.1.55472 WP_001124469.1.55482 WP_001124469.1.55483 WP_001124469.1.55489 WP_001124469.1.55492 WP_001124469.1.55529 WP_001124469.1.55551 WP_001124469.1.55552 WP_001124469.1.55556 WP_001124469.1.55560 WP_001124469.1.55563 WP_001124469.1.55571 WP_001124469.1.55574 WP_001124469.1.55581 WP_001124469.1.55597 WP_001124469.1.55608 WP_001124469.1.5561 WP_001124469.1.55629 WP_001124469.1.5566 WP_001124469.1.55709 WP_001124469.1.55720 WP_001124469.1.55727 WP_001124469.1.55730 WP_001124469.1.55757 WP_001124469.1.55787 WP_001124469.1.55820 WP_001124469.1.55825 WP_001124469.1.55838 WP_001124469.1.55844 WP_001124469.1.55868 WP_001124469.1.55870 WP_001124469.1.55892 WP_001124469.1.55897 WP_001124469.1.55979 WP_001124469.1.55988 WP_001124469.1.56072 WP_001124469.1.56101 WP_001124469.1.5614 WP_001124469.1.56149 WP_001124469.1.56151 WP_001124469.1.5616 WP_001124469.1.56164 WP_001124469.1.56169 WP_001124469.1.56177 WP_001124469.1.56193 WP_001124469.1.56197 WP_001124469.1.56216 WP_001124469.1.56231 WP_001124469.1.56285 WP_001124469.1.56302 WP_001124469.1.56345 WP_001124469.1.56358 WP_001124469.1.56388 WP_001124469.1.5639 WP_001124469.1.56390 WP_001124469.1.56392 WP_001124469.1.56399 WP_001124469.1.56436 WP_001124469.1.56439 WP_001124469.1.56446 WP_001124469.1.5646 WP_001124469.1.56481 WP_001124469.1.56489 WP_001124469.1.5649 WP_001124469.1.56491 WP_001124469.1.56513 WP_001124469.1.56528 WP_001124469.1.56543 WP_001124469.1.56554 WP_001124469.1.56571 WP_001124469.1.56586 WP_001124469.1.56665 WP_001124469.1.56680 WP_001124469.1.56689 WP_001124469.1.5670 WP_001124469.1.56704 WP_001124469.1.56713 WP_001124469.1.56721 WP_001124469.1.56742 WP_001124469.1.56776 WP_001124469.1.56777 WP_001124469.1.56786 WP_001124469.1.56787 WP_001124469.1.56799 WP_001124469.1.56835 WP_001124469.1.56846 WP_001124469.1.56871 WP_001124469.1.56882 WP_001124469.1.56885 WP_001124469.1.56908 WP_001124469.1.56932 WP_001124469.1.56934 WP_001124469.1.56937 WP_001124469.1.56951 WP_001124469.1.56980 WP_001124469.1.56992 WP_001124469.1.57032 WP_001124469.1.57051 WP_001124469.1.57068 WP_001124469.1.57071 WP_001124469.1.57072 WP_001124469.1.57086 WP_001124469.1.57100 WP_001124469.1.57124 WP_001124469.1.57150 WP_001124469.1.57180 WP_001124469.1.57181 WP_001124469.1.57185 WP_001124469.1.57197 WP_001124469.1.57216 WP_001124469.1.57254 WP_001124469.1.57269 WP_001124469.1.57280 WP_001124469.1.57281 WP_001124469.1.57319 WP_001124469.1.57348 WP_001124469.1.57349 WP_001124469.1.57395 WP_001124469.1.57403 WP_001124469.1.57410 WP_001124469.1.57414 WP_001124469.1.57432 WP_001124469.1.57453 WP_001124469.1.57466 WP_001124469.1.5748 WP_001124469.1.57487 WP_001124469.1.57492 WP_001124469.1.57517 WP_001124469.1.57538 WP_001124469.1.5755 WP_001124469.1.57550 WP_001124469.1.57558 WP_001124469.1.57574 WP_001124469.1.57588 WP_001124469.1.57610 WP_001124469.1.57628 WP_001124469.1.57629 WP_001124469.1.57634 WP_001124469.1.57638 WP_001124469.1.5764 WP_001124469.1.57646 WP_001124469.1.57659 WP_001124469.1.57663 WP_001124469.1.57669 WP_001124469.1.57738 WP_001124469.1.57812 WP_001124469.1.57814 WP_001124469.1.57836 WP_001124469.1.57846 WP_001124469.1.57851 WP_001124469.1.57898 WP_001124469.1.57903 WP_001124469.1.57904 WP_001124469.1.57920 WP_001124469.1.57951 WP_001124469.1.57975 WP_001124469.1.58001 WP_001124469.1.58022 WP_001124469.1.58045 WP_001124469.1.58048 WP_001124469.1.58057 WP_001124469.1.58060 WP_001124469.1.58080 WP_001124469.1.5812 WP_001124469.1.58128 WP_001124469.1.58136 WP_001124469.1.58143 WP_001124469.1.58146 WP_001124469.1.58163 WP_001124469.1.58169 WP_001124469.1.58172 WP_001124469.1.58206 WP_001124469.1.58226 WP_001124469.1.58232 WP_001124469.1.58238 WP_001124469.1.58267 WP_001124469.1.58289 WP_001124469.1.58340 WP_001124469.1.58368 WP_001124469.1.58384 WP_001124469.1.584 WP_001124469.1.58408 WP_001124469.1.5842 WP_001124469.1.58420 WP_001124469.1.58423 WP_001124469.1.58429 WP_001124469.1.58440 WP_001124469.1.58445 WP_001124469.1.58475 WP_001124469.1.58484 WP_001124469.1.58496 WP_001124469.1.58507 WP_001124469.1.58514 WP_001124469.1.5852 WP_001124469.1.58528 WP_001124469.1.58572 WP_001124469.1.58582 WP_001124469.1.58622 WP_001124469.1.58680 WP_001124469.1.58692 WP_001124469.1.58705 WP_001124469.1.58707 WP_001124469.1.58723 WP_001124469.1.58837 WP_001124469.1.58867 WP_001124469.1.58870 WP_001124469.1.58901 WP_001124469.1.58940 WP_001124469.1.58942 WP_001124469.1.58951 WP_001124469.1.58958 WP_001124469.1.58976 WP_001124469.1.58977 WP_001124469.1.58983 WP_001124469.1.59024 WP_001124469.1.59026 WP_001124469.1.59038 WP_001124469.1.59047 WP_001124469.1.5906 WP_001124469.1.59083 WP_001124469.1.59119 WP_001124469.1.59165 WP_001124469.1.59174 WP_001124469.1.59190 WP_001124469.1.59199 WP_001124469.1.59218 WP_001124469.1.59226 WP_001124469.1.59280 WP_001124469.1.59293 WP_001124469.1.59302 WP_001124469.1.59306 WP_001124469.1.59359 WP_001124469.1.59374 WP_001124469.1.59395 WP_001124469.1.59396 WP_001124469.1.59407 WP_001124469.1.59409 WP_001124469.1.59413 WP_001124469.1.59423 WP_001124469.1.59434 WP_001124469.1.59470 WP_001124469.1.59491 WP_001124469.1.59553 WP_001124469.1.59577 WP_001124469.1.59590 WP_001124469.1.59611 WP_001124469.1.59615 WP_001124469.1.59621 WP_001124469.1.59638 WP_001124469.1.5965 WP_001124469.1.59679 WP_001124469.1.59689 WP_001124469.1.59699 WP_001124469.1.597 WP_001124469.1.59717 WP_001124469.1.59730 WP_001124469.1.59733 WP_001124469.1.59737 WP_001124469.1.59756 WP_001124469.1.59781 WP_001124469.1.59782 WP_001124469.1.59791 WP_001124469.1.59823 WP_001124469.1.59836 WP_001124469.1.59838 WP_001124469.1.59855 WP_001124469.1.59858 WP_001124469.1.59877 WP_001124469.1.5990 WP_001124469.1.59905 WP_001124469.1.59912 WP_001124469.1.59914 WP_001124469.1.59931 WP_001124469.1.59932 WP_001124469.1.59959 WP_001124469.1.59980 WP_001124469.1.59989 WP_001124469.1.59998 WP_001124469.1.60005 WP_001124469.1.6002 WP_001124469.1.60031 WP_001124469.1.60042 WP_001124469.1.60043 WP_001124469.1.60070 WP_001124469.1.60095 WP_001124469.1.60110 WP_001124469.1.60117 WP_001124469.1.6013 WP_001124469.1.60151 WP_001124469.1.60186 WP_001124469.1.6022 WP_001124469.1.60228 WP_001124469.1.60246 WP_001124469.1.60304 WP_001124469.1.60325 WP_001124469.1.60342 WP_001124469.1.60343 WP_001124469.1.60374 WP_001124469.1.60387 WP_001124469.1.60436 WP_001124469.1.60443 WP_001124469.1.60453 WP_001124469.1.60457 WP_001124469.1.60461 WP_001124469.1.60477 WP_001124469.1.60491 WP_001124469.1.60498 WP_001124469.1.60550 WP_001124469.1.60559 WP_001124469.1.60567 WP_001124469.1.60570 WP_001124469.1.60576 WP_001124469.1.6059 WP_001124469.1.60599 WP_001124469.1.60606 WP_001124469.1.6061 WP_001124469.1.60613 WP_001124469.1.60614 WP_001124469.1.6064 WP_001124469.1.60644 WP_001124469.1.60647 WP_001124469.1.6066 WP_001124469.1.60671 WP_001124469.1.60684 WP_001124469.1.60698 WP_001124469.1.60717 WP_001124469.1.60732 WP_001124469.1.60744 WP_001124469.1.60761 WP_001124469.1.60771 WP_001124469.1.60805 WP_001124469.1.60816 WP_001124469.1.60826 WP_001124469.1.60832 WP_001124469.1.60835 WP_001124469.1.60847 WP_001124469.1.60872 WP_001124469.1.60895 WP_001124469.1.60901 WP_001124469.1.60921 WP_001124469.1.60925 WP_001124469.1.60927 WP_001124469.1.60935 WP_001124469.1.6094 WP_001124469.1.60974 WP_001124469.1.61005 WP_001124469.1.61008 WP_001124469.1.61035 WP_001124469.1.61039 WP_001124469.1.61058 WP_001124469.1.61096 WP_001124469.1.61097 WP_001124469.1.61099 WP_001124469.1.6110 WP_001124469.1.61102 WP_001124469.1.61108 WP_001124469.1.61112 WP_001124469.1.61148 WP_001124469.1.61174 WP_001124469.1.61181 WP_001124469.1.61183 WP_001124469.1.61186 WP_001124469.1.61223 WP_001124469.1.61225 WP_001124469.1.61241 WP_001124469.1.61253 WP_001124469.1.61268 WP_001124469.1.61292 WP_001124469.1.61362 WP_001124469.1.61373 WP_001124469.1.61398 WP_001124469.1.61496 WP_001124469.1.61517 WP_001124469.1.61524 WP_001124469.1.61551 WP_001124469.1.61608 WP_001124469.1.61612 WP_001124469.1.61623 WP_001124469.1.61636 WP_001124469.1.61643 WP_001124469.1.61663 WP_001124469.1.61703 WP_001124469.1.61718 WP_001124469.1.61758 WP_001124469.1.61772 WP_001124469.1.61779 WP_001124469.1.618 WP_001124469.1.61806 WP_001124469.1.61853 WP_001124469.1.61858 WP_001124469.1.61874 WP_001124469.1.61893 WP_001124469.1.61926 WP_001124469.1.61939 WP_001124469.1.61948 WP_001124469.1.61949 WP_001124469.1.61955 WP_001124469.1.61957 WP_001124469.1.61966 WP_001124469.1.62041 WP_001124469.1.6212 WP_001124469.1.62135 WP_001124469.1.62157 WP_001124469.1.62182 WP_001124469.1.62207 WP_001124469.1.62264 WP_001124469.1.62266 WP_001124469.1.62273 WP_001124469.1.62282 WP_001124469.1.62290 WP_001124469.1.62296 WP_001124469.1.62303 WP_001124469.1.62337 WP_001124469.1.62348 WP_001124469.1.62447 WP_001124469.1.6245 WP_001124469.1.62460 WP_001124469.1.62480 WP_001124469.1.62481 WP_001124469.1.62487 WP_001124469.1.62507 WP_001124469.1.62513 WP_001124469.1.62514 WP_001124469.1.62529 WP_001124469.1.6261 WP_001124469.1.62612 WP_001124469.1.62642 WP_001124469.1.62646 WP_001124469.1.62675 WP_001124469.1.62681 WP_001124469.1.62714 WP_001124469.1.62735 WP_001124469.1.62750 WP_001124469.1.62762 WP_001124469.1.62769 WP_001124469.1.62787 WP_001124469.1.62802 WP_001124469.1.62812 WP_001124469.1.62818 WP_001124469.1.62840 WP_001124469.1.62843 WP_001124469.1.62850 WP_001124469.1.62851 WP_001124469.1.62888 WP_001124469.1.62914 WP_001124469.1.62919 WP_001124469.1.6293 WP_001124469.1.62931 WP_001124469.1.62959 WP_001124469.1.62973 WP_001124469.1.62989 WP_001124469.1.6299 WP_001124469.1.62992 WP_001124469.1.63023 WP_001124469.1.63078 WP_001124469.1.63167 WP_001124469.1.63177 WP_001124469.1.63189 WP_001124469.1.63246 WP_001124469.1.63287 WP_001124469.1.6331 WP_001124469.1.6334 WP_001124469.1.63350 WP_001124469.1.63370 WP_001124469.1.63374 WP_001124469.1.63393 WP_001124469.1.63435 WP_001124469.1.63437 WP_001124469.1.63445 WP_001124469.1.63453 WP_001124469.1.63467 WP_001124469.1.63470 WP_001124469.1.63478 WP_001124469.1.63484 WP_001124469.1.63491 WP_001124469.1.63536 WP_001124469.1.63554 WP_001124469.1.63556 WP_001124469.1.63563 WP_001124469.1.63576 WP_001124469.1.63586 WP_001124469.1.63602 WP_001124469.1.63612 WP_001124469.1.63615 WP_001124469.1.6364 WP_001124469.1.63666 WP_001124469.1.63679 WP_001124469.1.63683 WP_001124469.1.63703 WP_001124469.1.63721 WP_001124469.1.63746 WP_001124469.1.63800 WP_001124469.1.63821 WP_001124469.1.63871 WP_001124469.1.63872 WP_001124469.1.63957 WP_001124469.1.63964 WP_001124469.1.63990 WP_001124469.1.64008 WP_001124469.1.64014 WP_001124469.1.64040 WP_001124469.1.64050 WP_001124469.1.64074 WP_001124469.1.64080 WP_001124469.1.64086 WP_001124469.1.64138 WP_001124469.1.64150 WP_001124469.1.64153 WP_001124469.1.6416 WP_001124469.1.64161 WP_001124469.1.64193 WP_001124469.1.64280 WP_001124469.1.64285 WP_001124469.1.64286 WP_001124469.1.64321 WP_001124469.1.64337 WP_001124469.1.64353 WP_001124469.1.64355 WP_001124469.1.64356 WP_001124469.1.64371 WP_001124469.1.64380 WP_001124469.1.64391 WP_001124469.1.6441 WP_001124469.1.64437 WP_001124469.1.64438 WP_001124469.1.64448 WP_001124469.1.6445 WP_001124469.1.64458 WP_001124469.1.64519 WP_001124469.1.64528 WP_001124469.1.64540 WP_001124469.1.64563 WP_001124469.1.64621 WP_001124469.1.64634 WP_001124469.1.64657 WP_001124469.1.6469 WP_001124469.1.64693 WP_001124469.1.647 WP_001124469.1.64707 WP_001124469.1.64746 WP_001124469.1.64749 WP_001124469.1.64789 WP_001124469.1.64793 WP_001124469.1.64821 WP_001124469.1.64866 WP_001124469.1.64881 WP_001124469.1.64895 WP_001124469.1.64912 WP_001124469.1.64930 WP_001124469.1.64939 WP_001124469.1.64946 WP_001124469.1.64970 WP_001124469.1.6499 WP_001124469.1.65023 WP_001124469.1.65035 WP_001124469.1.65040 WP_001124469.1.65056 WP_001124469.1.65084 WP_001124469.1.65085 WP_001124469.1.65097 WP_001124469.1.651 WP_001124469.1.6511 WP_001124469.1.65110 WP_001124469.1.65118 WP_001124469.1.65135 WP_001124469.1.65155 WP_001124469.1.6516 WP_001124469.1.65179 WP_001124469.1.65192 WP_001124469.1.65194 WP_001124469.1.65206 WP_001124469.1.65271 WP_001124469.1.65296 WP_001124469.1.65305 WP_001124469.1.65306 WP_001124469.1.65353 WP_001124469.1.65364 WP_001124469.1.6537 WP_001124469.1.65370 WP_001124469.1.65372 WP_001124469.1.654 WP_001124469.1.65408 WP_001124469.1.65413 WP_001124469.1.65415 WP_001124469.1.65484 WP_001124469.1.65493 WP_001124469.1.6553 WP_001124469.1.65531 WP_001124469.1.65546 WP_001124469.1.65581 WP_001124469.1.6563 WP_001124469.1.65662 WP_001124469.1.65667 WP_001124469.1.65672 WP_001124469.1.65677 WP_001124469.1.65708 WP_001124469.1.65749 WP_001124469.1.65762 WP_001124469.1.6587 WP_001124469.1.65875 WP_001124469.1.65898 WP_001124469.1.65912 WP_001124469.1.65954 WP_001124469.1.65961 WP_001124469.1.65962 WP_001124469.1.65963 WP_001124469.1.65978 WP_001124469.1.65988 WP_001124469.1.6599 WP_001124469.1.65991 WP_001124469.1.66001 WP_001124469.1.66007 WP_001124469.1.66033 WP_001124469.1.6604 WP_001124469.1.66059 WP_001124469.1.66094 WP_001124469.1.66100 WP_001124469.1.66102 WP_001124469.1.66104 WP_001124469.1.66121 WP_001124469.1.66181 WP_001124469.1.66187 WP_001124469.1.66197 WP_001124469.1.6622 WP_001124469.1.66251 WP_001124469.1.66264 WP_001124469.1.66280 WP_001124469.1.66288 WP_001124469.1.66335 WP_001124469.1.6635 WP_001124469.1.66387 WP_001124469.1.66389 WP_001124469.1.66395 WP_001124469.1.66412 WP_001124469.1.66432 WP_001124469.1.6645 WP_001124469.1.66501 WP_001124469.1.66531 WP_001124469.1.6654 WP_001124469.1.66550 WP_001124469.1.66559 WP_001124469.1.66566 WP_001124469.1.66579 WP_001124469.1.66624 WP_001124469.1.66644 WP_001124469.1.6665 WP_001124469.1.66667 WP_001124469.1.66700 WP_001124469.1.66719 WP_001124469.1.66758 WP_001124469.1.6676 WP_001124469.1.66791 WP_001124469.1.66795 WP_001124469.1.66796 WP_001124469.1.66849 WP_001124469.1.66873 WP_001124469.1.66922 WP_001124469.1.66926 WP_001124469.1.66933 WP_001124469.1.66948 WP_001124469.1.66975 WP_001124469.1.66978 WP_001124469.1.6701 WP_001124469.1.67018 WP_001124469.1.67021 WP_001124469.1.67022 WP_001124469.1.67026 WP_001124469.1.67073 WP_001124469.1.67102 WP_001124469.1.67116 WP_001124469.1.67120 WP_001124469.1.67136 WP_001124469.1.67149 WP_001124469.1.67150 WP_001124469.1.67158 WP_001124469.1.67193 WP_001124469.1.67194 WP_001124469.1.67200 WP_001124469.1.67209 WP_001124469.1.67210 WP_001124469.1.67214 WP_001124469.1.6723 WP_001124469.1.67278 WP_001124469.1.67293 WP_001124469.1.6735 WP_001124469.1.67383 WP_001124469.1.67412 WP_001124469.1.67415 WP_001124469.1.67446 WP_001124469.1.67451 WP_001124469.1.67452 WP_001124469.1.67454 WP_001124469.1.67462 WP_001124469.1.67467 WP_001124469.1.67468 WP_001124469.1.67522 WP_001124469.1.67533 WP_001124469.1.67549 WP_001124469.1.67553 WP_001124469.1.67581 WP_001124469.1.67660 WP_001124469.1.67663 WP_001124469.1.67676 WP_001124469.1.6769 WP_001124469.1.67701 WP_001124469.1.67704 WP_001124469.1.67724 WP_001124469.1.67726 WP_001124469.1.67732 WP_001124469.1.67753 WP_001124469.1.67758 WP_001124469.1.67775 WP_001124469.1.67780 WP_001124469.1.67786 WP_001124469.1.67788 WP_001124469.1.67802 WP_001124469.1.67810 WP_001124469.1.67841 WP_001124469.1.67853 WP_001124469.1.67861 WP_001124469.1.67901 WP_001124469.1.67938 WP_001124469.1.67984 WP_001124469.1.67999 WP_001124469.1.68008 WP_001124469.1.68011 WP_001124469.1.68012 WP_001124469.1.6802 WP_001124469.1.68025 WP_001124469.1.6803 WP_001124469.1.68039 WP_001124469.1.68053 WP_001124469.1.68067 WP_001124469.1.68069 WP_001124469.1.68079 WP_001124469.1.68096 WP_001124469.1.68108 WP_001124469.1.68126 WP_001124469.1.6814 WP_001124469.1.68145 WP_001124469.1.68170 WP_001124469.1.68175 WP_001124469.1.682 WP_001124469.1.68215 WP_001124469.1.68241 WP_001124469.1.68255 WP_001124469.1.68271 WP_001124469.1.68278 WP_001124469.1.68281 WP_001124469.1.68300 WP_001124469.1.68336 WP_001124469.1.68341 WP_001124469.1.68347 WP_001124469.1.68369 WP_001124469.1.68396 WP_001124469.1.68411 WP_001124469.1.68442 WP_001124469.1.68482 WP_001124469.1.68490 WP_001124469.1.68493 WP_001124469.1.68523 WP_001124469.1.68566 WP_001124469.1.68584 WP_001124469.1.68598 WP_001124469.1.6860 WP_001124469.1.68609 WP_001124469.1.68630 WP_001124469.1.68635 WP_001124469.1.68673 WP_001124469.1.68678 WP_001124469.1.68679 WP_001124469.1.68695 WP_001124469.1.68697 WP_001124469.1.68711 WP_001124469.1.68731 WP_001124469.1.68751 WP_001124469.1.68752 WP_001124469.1.68797 WP_001124469.1.6880 WP_001124469.1.68801 WP_001124469.1.68865 WP_001124469.1.6887 WP_001124469.1.68873 WP_001124469.1.68880 WP_001124469.1.6892 WP_001124469.1.68936 WP_001124469.1.68961 WP_001124469.1.6897 WP_001124469.1.68989 WP_001124469.1.69039 WP_001124469.1.69054 WP_001124469.1.69098 WP_001124469.1.69126 WP_001124469.1.69127 WP_001124469.1.69144 WP_001124469.1.6916 WP_001124469.1.6919 WP_001124469.1.69192 WP_001124469.1.6923 WP_001124469.1.69247 WP_001124469.1.69261 WP_001124469.1.6929 WP_001124469.1.69305 WP_001124469.1.69341 WP_001124469.1.69350 WP_001124469.1.69351 WP_001124469.1.69390 WP_001124469.1.694 WP_001124469.1.69404 WP_001124469.1.69441 WP_001124469.1.6945 WP_001124469.1.69472 WP_001124469.1.69473 WP_001124469.1.69537 WP_001124469.1.69551 WP_001124469.1.69569 WP_001124469.1.69589 WP_001124469.1.69593 WP_001124469.1.69596 WP_001124469.1.69646 WP_001124469.1.69649 WP_001124469.1.69689 WP_001124469.1.69730 WP_001124469.1.69780 WP_001124469.1.69803 WP_001124469.1.69810 WP_001124469.1.69818 WP_001124469.1.69868 WP_001124469.1.69872 WP_001124469.1.69896 WP_001124469.1.6993 WP_001124469.1.69972 WP_001124469.1.69979 WP_001124469.1.70063 WP_001124469.1.70081 WP_001124469.1.70123 WP_001124469.1.70125 WP_001124469.1.70149 WP_001124469.1.70190 WP_001124469.1.70191 WP_001124469.1.70200 WP_001124469.1.70213 WP_001124469.1.70251 WP_001124469.1.70256 WP_001124469.1.70299 WP_001124469.1.70341 WP_001124469.1.70357 WP_001124469.1.70370 WP_001124469.1.70407 WP_001124469.1.70414 WP_001124469.1.70477 WP_001124469.1.70492 WP_001124469.1.70509 WP_001124469.1.70517 WP_001124469.1.7052 WP_001124469.1.70530 WP_001124469.1.70539 WP_001124469.1.70576 WP_001124469.1.70582 WP_001124469.1.70592 WP_001124469.1.70600 WP_001124469.1.70628 WP_001124469.1.70656 WP_001124469.1.70694 WP_001124469.1.70698 WP_001124469.1.70705 WP_001124469.1.70713 WP_001124469.1.70723 WP_001124469.1.70728 WP_001124469.1.70745 WP_001124469.1.70747 WP_001124469.1.70748 WP_001124469.1.70787 WP_001124469.1.70794 WP_001124469.1.70801 WP_001124469.1.70803 WP_001124469.1.70880 WP_001124469.1.7090 WP_001124469.1.70900 WP_001124469.1.70952 WP_001124469.1.70967 WP_001124469.1.71003 WP_001124469.1.7102 WP_001124469.1.71024 WP_001124469.1.71037 WP_001124469.1.71042 WP_001124469.1.71062 WP_001124469.1.71099 WP_001124469.1.71109 WP_001124469.1.71113 WP_001124469.1.71134 WP_001124469.1.71147 WP_001124469.1.71149 WP_001124469.1.71158 WP_001124469.1.71159 WP_001124469.1.71162 WP_001124469.1.71170 WP_001124469.1.71176 WP_001124469.1.71192 WP_001124469.1.71199 WP_001124469.1.71205 WP_001124469.1.71221 WP_001124469.1.71223 WP_001124469.1.71225 WP_001124469.1.71226 WP_001124469.1.71264 WP_001124469.1.71269 WP_001124469.1.71272 WP_001124469.1.71273 WP_001124469.1.71275 WP_001124469.1.71285 WP_001124469.1.71323 WP_001124469.1.71327 WP_001124469.1.71339 WP_001124469.1.71397 WP_001124469.1.71403 WP_001124469.1.71423 WP_001124469.1.71448 WP_001124469.1.7147 WP_001124469.1.71522 WP_001124469.1.71533 WP_001124469.1.71537 WP_001124469.1.71540 WP_001124469.1.71560 WP_001124469.1.71603 WP_001124469.1.71632 WP_001124469.1.71680 WP_001124469.1.71690 WP_001124469.1.71695 WP_001124469.1.71724 WP_001124469.1.71757 WP_001124469.1.71767 WP_001124469.1.71783 WP_001124469.1.71832 WP_001124469.1.71837 WP_001124469.1.71840 WP_001124469.1.71856 WP_001124469.1.71874 WP_001124469.1.71912 WP_001124469.1.7192 WP_001124469.1.71922 WP_001124469.1.71938 WP_001124469.1.71940 WP_001124469.1.71944 WP_001124469.1.71945 WP_001124469.1.71975 WP_001124469.1.71987 WP_001124469.1.71993 WP_001124469.1.72013 WP_001124469.1.72016 WP_001124469.1.72021 WP_001124469.1.72033 WP_001124469.1.72053 WP_001124469.1.72054 WP_001124469.1.72090 WP_001124469.1.7210 WP_001124469.1.72120 WP_001124469.1.72125 WP_001124469.1.72126 WP_001124469.1.72141 WP_001124469.1.72153 WP_001124469.1.72155 WP_001124469.1.72157 WP_001124469.1.72180 WP_001124469.1.72240 WP_001124469.1.7225 WP_001124469.1.72261 WP_001124469.1.72262 WP_001124469.1.72270 WP_001124469.1.72279 WP_001124469.1.72293 WP_001124469.1.72322 WP_001124469.1.72337 WP_001124469.1.72342 WP_001124469.1.72362 WP_001124469.1.72391 WP_001124469.1.72392 WP_001124469.1.72397 WP_001124469.1.72414 WP_001124469.1.72427 WP_001124469.1.72431 WP_001124469.1.72449 WP_001124469.1.72485 WP_001124469.1.72493 WP_001124469.1.72521 WP_001124469.1.72522 WP_001124469.1.72535 WP_001124469.1.72537 WP_001124469.1.72544 WP_001124469.1.72574 WP_001124469.1.72582 WP_001124469.1.72593 WP_001124469.1.72608 WP_001124469.1.72614 WP_001124469.1.72615 WP_001124469.1.72641 WP_001124469.1.72643 WP_001124469.1.72651 WP_001124469.1.72652 WP_001124469.1.72663 WP_001124469.1.72694 WP_001124469.1.72695 WP_001124469.1.72698 WP_001124469.1.72725 WP_001124469.1.72729 WP_001124469.1.72738 WP_001124469.1.72747 WP_001124469.1.72748 WP_001124469.1.72751 WP_001124469.1.72758 WP_001124469.1.72764 WP_001124469.1.7277 WP_001124469.1.72778 WP_001124469.1.72804 WP_001124469.1.72806 WP_001124469.1.72837 WP_001124469.1.72858 WP_001124469.1.72860 WP_001124469.1.7291 WP_001124469.1.72910 WP_001124469.1.72913 WP_001124469.1.72956 WP_001124469.1.72998 WP_001124469.1.73010 WP_001124469.1.73015 WP_001124469.1.73032 WP_001124469.1.73072 WP_001124469.1.73075 WP_001124469.1.73085 WP_001124469.1.73126 WP_001124469.1.73193 WP_001124469.1.73217 WP_001124469.1.73230 WP_001124469.1.73239 WP_001124469.1.73249 WP_001124469.1.73251 WP_001124469.1.73257 WP_001124469.1.73259 WP_001124469.1.73278 WP_001124469.1.73295 WP_001124469.1.73326 WP_001124469.1.73340 WP_001124469.1.73343 WP_001124469.1.73349 WP_001124469.1.73385 WP_001124469.1.73393 WP_001124469.1.73428 WP_001124469.1.73468 WP_001124469.1.7349 WP_001124469.1.73498 WP_001124469.1.73565 WP_001124469.1.73592 WP_001124469.1.73604 WP_001124469.1.73626 WP_001124469.1.73631 WP_001124469.1.73652 WP_001124469.1.73663 WP_001124469.1.73709 WP_001124469.1.73717 WP_001124469.1.73743 WP_001124469.1.7376 WP_001124469.1.73785 WP_001124469.1.73797 WP_001124469.1.73801 WP_001124469.1.73807 WP_001124469.1.73811 WP_001124469.1.73827 WP_001124469.1.73835 WP_001124469.1.73843 WP_001124469.1.73859 WP_001124469.1.73882 WP_001124469.1.73897 WP_001124469.1.73908 WP_001124469.1.7392 WP_001124469.1.73934 WP_001124469.1.73942 WP_001124469.1.73968 WP_001124469.1.73980 WP_001124469.1.73992 WP_001124469.1.73996 WP_001124469.1.74051 WP_001124469.1.74053 WP_001124469.1.74123 WP_001124469.1.7413 WP_001124469.1.74156 WP_001124469.1.74184 WP_001124469.1.74213 WP_001124469.1.74223 WP_001124469.1.7424 WP_001124469.1.74243 WP_001124469.1.7425 WP_001124469.1.74251 WP_001124469.1.7429 WP_001124469.1.74294 WP_001124469.1.74309 WP_001124469.1.74365 WP_001124469.1.74423 WP_001124469.1.74431 WP_001124469.1.74444 WP_001124469.1.7446 WP_001124469.1.74465 WP_001124469.1.74478 WP_001124469.1.74491 WP_001124469.1.74501 WP_001124469.1.74509 WP_001124469.1.74513 WP_001124469.1.74520 WP_001124469.1.74521 WP_001124469.1.74528 WP_001124469.1.74532 WP_001124469.1.74536 WP_001124469.1.74549 WP_001124469.1.74557 WP_001124469.1.7461 WP_001124469.1.74624 WP_001124469.1.74625 WP_001124469.1.74652 WP_001124469.1.74687 WP_001124469.1.74689 WP_001124469.1.74691 WP_001124469.1.74705 WP_001124469.1.7471 WP_001124469.1.74716 WP_001124469.1.74720 WP_001124469.1.74735 WP_001124469.1.7475 WP_001124469.1.74752 WP_001124469.1.7478 WP_001124469.1.7479 WP_001124469.1.74793 WP_001124469.1.74811 WP_001124469.1.74828 WP_001124469.1.74844 WP_001124469.1.74852 WP_001124469.1.74854 WP_001124469.1.74860 WP_001124469.1.74867 WP_001124469.1.74873 WP_001124469.1.74879 WP_001124469.1.74885 WP_001124469.1.74889 WP_001124469.1.74904 WP_001124469.1.74914 WP_001124469.1.74975 WP_001124469.1.74993 WP_001124469.1.74998 WP_001124469.1.75003 WP_001124469.1.75021 WP_001124469.1.75029 WP_001124469.1.75030 WP_001124469.1.75112 WP_001124469.1.75124 WP_001124469.1.75136 WP_001124469.1.75138 WP_001124469.1.75143 WP_001124469.1.75145 WP_001124469.1.75149 WP_001124469.1.75155 WP_001124469.1.75164 WP_001124469.1.75181 WP_001124469.1.75209 WP_001124469.1.75219 WP_001124469.1.75221 WP_001124469.1.75243 WP_001124469.1.75247 WP_001124469.1.75248 WP_001124469.1.75254 WP_001124469.1.75270 WP_001124469.1.75272 WP_001124469.1.7536 WP_001124469.1.75360 WP_001124469.1.75382 WP_001124469.1.7539 WP_001124469.1.75428 WP_001124469.1.75465 WP_001124469.1.75491 WP_001124469.1.75505 WP_001124469.1.75507 WP_001124469.1.75529 WP_001124469.1.75536 WP_001124469.1.75537 WP_001124469.1.75568 WP_001124469.1.75577 WP_001124469.1.75588 WP_001124469.1.75594 WP_001124469.1.75602 WP_001124469.1.75612 WP_001124469.1.75629 WP_001124469.1.75672 WP_001124469.1.75676 WP_001124469.1.75679 WP_001124469.1.75687 WP_001124469.1.75694 WP_001124469.1.75696 WP_001124469.1.75698 WP_001124469.1.75735 WP_001124469.1.75758 WP_001124469.1.75767 WP_001124469.1.75803 WP_001124469.1.7583 WP_001124469.1.7597 WP_001124469.1.75973 WP_001124469.1.75983 WP_001124469.1.75989 WP_001124469.1.75995 WP_001124469.1.75999 WP_001124469.1.76005 WP_001124469.1.76009 WP_001124469.1.7603 WP_001124469.1.76036 WP_001124469.1.76039 WP_001124469.1.76054 WP_001124469.1.7608 WP_001124469.1.76089 WP_001124469.1.76103 WP_001124469.1.76118 WP_001124469.1.76152 WP_001124469.1.76184 WP_001124469.1.76189 WP_001124469.1.76196 WP_001124469.1.76211 WP_001124469.1.76312 WP_001124469.1.76325 WP_001124469.1.76361 WP_001124469.1.7637 WP_001124469.1.76376 WP_001124469.1.76384 WP_001124469.1.76387 WP_001124469.1.76390 WP_001124469.1.76407 WP_001124469.1.76446 WP_001124469.1.76447 WP_001124469.1.76448 WP_001124469.1.76452 WP_001124469.1.76460 WP_001124469.1.76462 WP_001124469.1.76466 WP_001124469.1.76477 WP_001124469.1.76542 WP_001124469.1.76544 WP_001124469.1.76547 WP_001124469.1.76595 WP_001124469.1.76612 WP_001124469.1.76619 WP_001124469.1.76656 WP_001124469.1.76697 WP_001124469.1.76701 WP_001124469.1.76705 WP_001124469.1.76707 WP_001124469.1.76712 WP_001124469.1.76815 WP_001124469.1.76827 WP_001124469.1.76840 WP_001124469.1.76884 WP_001124469.1.76909 WP_001124469.1.76918 WP_001124469.1.76948 WP_001124469.1.76957 WP_001124469.1.76965 WP_001124469.1.76966 WP_001124469.1.7699 WP_001124469.1.77015 WP_001124469.1.77022 WP_001124469.1.77070 WP_001124469.1.77099 WP_001124469.1.77109 WP_001124469.1.77120 WP_001124469.1.77128 WP_001124469.1.77147 WP_001124469.1.77162 WP_001124469.1.77163 WP_001124469.1.77198 WP_001124469.1.77214 WP_001124469.1.77239 WP_001124469.1.77253 WP_001124469.1.77255 WP_001124469.1.77258 WP_001124469.1.77275 WP_001124469.1.7728 WP_001124469.1.77284 WP_001124469.1.77288 WP_001124469.1.77291 WP_001124469.1.7731 WP_001124469.1.77341 WP_001124469.1.77358 WP_001124469.1.77391 WP_001124469.1.77392 WP_001124469.1.77437 WP_001124469.1.77448 WP_001124469.1.77452 WP_001124469.1.77462 WP_001124469.1.77471 WP_001124469.1.77477 WP_001124469.1.77495 WP_001124469.1.775 WP_001124469.1.77503 WP_001124469.1.77542 WP_001124469.1.77551 WP_001124469.1.77581 WP_001124469.1.77595 WP_001124469.1.77600 WP_001124469.1.77608 WP_001124469.1.77626 WP_001124469.1.77636 WP_001124469.1.77644 WP_001124469.1.77648 WP_001124469.1.77657 WP_001124469.1.77707 WP_001124469.1.77725 WP_001124469.1.77741 WP_001124469.1.77760 WP_001124469.1.77767 WP_001124469.1.77768 WP_001124469.1.7781 WP_001124469.1.77813 WP_001124469.1.77826 WP_001124469.1.77876 WP_001124469.1.77929 WP_001124469.1.77949 WP_001124469.1.7795 WP_001124469.1.77961 WP_001124469.1.77979 WP_001124469.1.7799 WP_001124469.1.77999 WP_001124469.1.78000 WP_001124469.1.78007 WP_001124469.1.78041 WP_001124469.1.78059 WP_001124469.1.7806 WP_001124469.1.78063 WP_001124469.1.7808 WP_001124469.1.78089 WP_001124469.1.78097 WP_001124469.1.78099 WP_001124469.1.78102 WP_001124469.1.78196 WP_001124469.1.78235 WP_001124469.1.78297 WP_001124469.1.78321 WP_001124469.1.78323 WP_001124469.1.78337 WP_001124469.1.78340 WP_001124469.1.78377 WP_001124469.1.78390 WP_001124469.1.784 WP_001124469.1.78445 WP_001124469.1.7847 WP_001124469.1.78481 WP_001124469.1.7851 WP_001124469.1.78515 WP_001124469.1.78523 WP_001124469.1.7855 WP_001124469.1.78553 WP_001124469.1.78581 WP_001124469.1.78583 WP_001124469.1.78586 WP_001124469.1.78593 WP_001124469.1.78610 WP_001124469.1.78611 WP_001124469.1.78612 WP_001124469.1.78645 WP_001124469.1.78683 WP_001124469.1.78687 WP_001124469.1.78696 WP_001124469.1.78698 WP_001124469.1.78718 WP_001124469.1.78746 WP_001124469.1.78750 WP_001124469.1.78757 WP_001124469.1.78775 WP_001124469.1.78791 WP_001124469.1.7883 WP_001124469.1.78843 WP_001124469.1.78854 WP_001124469.1.78888 WP_001124469.1.78891 WP_001124469.1.78919 WP_001124469.1.78953 WP_001124469.1.7896 WP_001124469.1.78966 WP_001124469.1.7898 WP_001124469.1.79002 WP_001124469.1.79004 WP_001124469.1.7901 WP_001124469.1.79067 WP_001124469.1.79075 WP_001124469.1.79086 WP_001124469.1.79088 WP_001124469.1.79090 WP_001124469.1.79092 WP_001124469.1.79172 WP_001124469.1.79226 WP_001124469.1.79306 WP_001124469.1.79308 WP_001124469.1.79312 WP_001124469.1.79343 WP_001124469.1.79346 WP_001124469.1.79356 WP_001124469.1.79369 WP_001124469.1.7937 WP_001124469.1.79391 WP_001124469.1.7940 WP_001124469.1.79416 WP_001124469.1.79464 WP_001124469.1.79478 WP_001124469.1.79505 WP_001124469.1.79519 WP_001124469.1.79525 WP_001124469.1.79528 WP_001124469.1.79540 WP_001124469.1.79558 WP_001124469.1.79563 WP_001124469.1.79576 WP_001124469.1.79591 WP_001124469.1.79606 WP_001124469.1.79685 WP_001124469.1.79713 WP_001124469.1.79715 WP_001124469.1.79800 WP_001124469.1.79816 WP_001124469.1.79824 WP_001124469.1.79840 WP_001124469.1.7985 WP_001124469.1.79866 WP_001124469.1.79869 WP_001124469.1.7987 WP_001124469.1.79877 WP_001124469.1.79905 WP_001124469.1.79922 WP_001124469.1.7993 WP_001124469.1.79930 WP_001124469.1.79932 WP_001124469.1.79936 WP_001124469.1.79944 WP_001124469.1.79965 WP_001124469.1.79984 WP_001124469.1.80011 WP_001124469.1.8004 WP_001124469.1.80043 WP_001124469.1.80050 WP_001124469.1.80060 WP_001124469.1.80061 WP_001124469.1.8007 WP_001124469.1.80106 WP_001124469.1.80112 WP_001124469.1.80136 WP_001124469.1.80141 WP_001124469.1.80176 WP_001124469.1.80179 WP_001124469.1.80192 WP_001124469.1.80255 WP_001124469.1.80292 WP_001124469.1.80309 WP_001124469.1.80310 WP_001124469.1.80320 WP_001124469.1.80330 WP_001124469.1.80343 WP_001124469.1.80388 WP_001124469.1.80402 WP_001124469.1.80426 WP_001124469.1.80428 WP_001124469.1.80440 WP_001124469.1.80456 WP_001124469.1.80463 WP_001124469.1.80484 WP_001124469.1.80517 WP_001124469.1.80524 WP_001124469.1.80545 WP_001124469.1.8057 WP_001124469.1.80578 WP_001124469.1.80594 WP_001124469.1.80606 WP_001124469.1.80612 WP_001124469.1.80626 WP_001124469.1.80662 WP_001124469.1.80666 WP_001124469.1.80676 WP_001124469.1.80709 WP_001124469.1.80731 WP_001124469.1.80736 WP_001124469.1.80737 WP_001124469.1.8074 WP_001124469.1.80753 WP_001124469.1.80754 WP_001124469.1.80756 WP_001124469.1.8076 WP_001124469.1.80768 WP_001124469.1.80789 WP_001124469.1.808 WP_001124469.1.80804 WP_001124469.1.80843 WP_001124469.1.80882 WP_001124469.1.80884 WP_001124469.1.80894 WP_001124469.1.8090 WP_001124469.1.8091 WP_001124469.1.80945 WP_001124469.1.80946 WP_001124469.1.80954 WP_001124469.1.80966 WP_001124469.1.80983 WP_001124469.1.80985 WP_001124469.1.810 WP_001124469.1.81026 WP_001124469.1.81034 WP_001124469.1.81036 WP_001124469.1.81054 WP_001124469.1.81070 WP_001124469.1.81071 WP_001124469.1.811 WP_001124469.1.81104 WP_001124469.1.81127 WP_001124469.1.81160 WP_001124469.1.81165 WP_001124469.1.81180 WP_001124469.1.81182 WP_001124469.1.8121 WP_001124469.1.81219 WP_001124469.1.81273 WP_001124469.1.81281 WP_001124469.1.81283 WP_001124469.1.81286 WP_001124469.1.8129 WP_001124469.1.81298 WP_001124469.1.81313 WP_001124469.1.81316 WP_001124469.1.81376 WP_001124469.1.81391 WP_001124469.1.81420 WP_001124469.1.81438 WP_001124469.1.81442 WP_001124469.1.81469 WP_001124469.1.81475 WP_001124469.1.81484 WP_001124469.1.81514 WP_001124469.1.81517 WP_001124469.1.8156 WP_001124469.1.81576 WP_001124469.1.81577 WP_001124469.1.81580 WP_001124469.1.81582 WP_001124469.1.81589 WP_001124469.1.81596 WP_001124469.1.81602 WP_001124469.1.81618 WP_001124469.1.81624 WP_001124469.1.81625 WP_001124469.1.81688 WP_001124469.1.81692 WP_001124469.1.8172 WP_001124469.1.81723 WP_001124469.1.81754 WP_001124469.1.81819 WP_001124469.1.81821 WP_001124469.1.81832 WP_001124469.1.81869 WP_001124469.1.81873 WP_001124469.1.81876 WP_001124469.1.81881 WP_001124469.1.81914 WP_001124469.1.81934 WP_001124469.1.81935 WP_001124469.1.81939 WP_001124469.1.81952 WP_001124469.1.81956 WP_001124469.1.81972 WP_001124469.1.81975 WP_001124469.1.82 WP_001124469.1.82010 WP_001124469.1.82032 WP_001124469.1.82057 WP_001124469.1.82059 WP_001124469.1.82061 WP_001124469.1.82062 WP_001124469.1.82074 WP_001124469.1.82095 WP_001124469.1.82116 WP_001124469.1.82137 WP_001124469.1.82217 WP_001124469.1.82239 WP_001124469.1.82240 WP_001124469.1.82242 WP_001124469.1.82246 WP_001124469.1.82275 WP_001124469.1.82280 WP_001124469.1.82296 WP_001124469.1.82316 WP_001124469.1.82320 WP_001124469.1.82326 WP_001124469.1.82330 WP_001124469.1.8235 WP_001124469.1.82378 WP_001124469.1.82438 WP_001124469.1.82439 WP_001124469.1.82485 WP_001124469.1.82499 WP_001124469.1.82507 WP_001124469.1.82536 WP_001124469.1.82572 WP_001124469.1.82594 WP_001124469.1.82614 WP_001124469.1.82626 WP_001124469.1.82629 WP_001124469.1.82647 WP_001124469.1.82661 WP_001124469.1.8268 WP_001124469.1.82682 WP_001124469.1.82700 WP_001124469.1.82705 WP_001124469.1.82711 WP_001124469.1.82715 WP_001124469.1.82718 WP_001124469.1.82754 WP_001124469.1.8277 WP_001124469.1.82780 WP_001124469.1.82797 WP_001124469.1.82799 WP_001124469.1.82820 WP_001124469.1.82831 WP_001124469.1.82853 WP_001124469.1.82901 WP_001124469.1.83020 WP_001124469.1.83033 WP_001124469.1.83035 WP_001124469.1.83051 WP_001124469.1.8306 WP_001124469.1.8308 WP_001124469.1.83099 WP_001124469.1.831 WP_001124469.1.83160 WP_001124469.1.83177 WP_001124469.1.83205 WP_001124469.1.83224 WP_001124469.1.83238 WP_001124469.1.83286 WP_001124469.1.83321 WP_001124469.1.83330 WP_001124469.1.83340 WP_001124469.1.83347 WP_001124469.1.83415 WP_001124469.1.8345 WP_001124469.1.83466 WP_001124469.1.83481 WP_001124469.1.83537 WP_001124469.1.83564 WP_001124469.1.83584 WP_001124469.1.83684 WP_001124469.1.83712 WP_001124469.1.83735 WP_001124469.1.83807 WP_001124469.1.83820 WP_001124469.1.83947 WP_001124469.1.84004 WP_001124469.1.84060 WP_001124469.1.84074 WP_001124469.1.8411 WP_001124469.1.84140 WP_001124469.1.84164 WP_001124469.1.84172 WP_001124469.1.84185 WP_001124469.1.84219 WP_001124469.1.84221 WP_001124469.1.84264 WP_001124469.1.84298 WP_001124469.1.84312 WP_001124469.1.84313 WP_001124469.1.84331 WP_001124469.1.84339 WP_001124469.1.84348 WP_001124469.1.84405 WP_001124469.1.84410 WP_001124469.1.84436 WP_001124469.1.8444 WP_001124469.1.84462 WP_001124469.1.84467 WP_001124469.1.84473 WP_001124469.1.84482 WP_001124469.1.84484 WP_001124469.1.84511 WP_001124469.1.84518 WP_001124469.1.84534 WP_001124469.1.84584 WP_001124469.1.84635 WP_001124469.1.84656 WP_001124469.1.84657 WP_001124469.1.84668 WP_001124469.1.84675 WP_001124469.1.8470 WP_001124469.1.84740 WP_001124469.1.84768 WP_001124469.1.8477 WP_001124469.1.84797 WP_001124469.1.84841 WP_001124469.1.84850 WP_001124469.1.84875 WP_001124469.1.84877 WP_001124469.1.84878 WP_001124469.1.84881 WP_001124469.1.84893 WP_001124469.1.84894 WP_001124469.1.84916 WP_001124469.1.84929 WP_001124469.1.84941 WP_001124469.1.84966 WP_001124469.1.84972 WP_001124469.1.84986 WP_001124469.1.84989 WP_001124469.1.84990 WP_001124469.1.84994 WP_001124469.1.85002 WP_001124469.1.85008 WP_001124469.1.85011 WP_001124469.1.85085 WP_001124469.1.85090 WP_001124469.1.85098 WP_001124469.1.85105 WP_001124469.1.85112 WP_001124469.1.85129 WP_001124469.1.85141 WP_001124469.1.85155 WP_001124469.1.85156 WP_001124469.1.85175 WP_001124469.1.85216 WP_001124469.1.85247 WP_001124469.1.85253 WP_001124469.1.85255 WP_001124469.1.85260 WP_001124469.1.85305 WP_001124469.1.85310 WP_001124469.1.85323 WP_001124469.1.85335 WP_001124469.1.85342 WP_001124469.1.85369 WP_001124469.1.85385 WP_001124469.1.85416 WP_001124469.1.85435 WP_001124469.1.85500 WP_001124469.1.85546 WP_001124469.1.85558 WP_001124469.1.85563 WP_001124469.1.85601 WP_001124469.1.85657 WP_001124469.1.85685 WP_001124469.1.85722 WP_001124469.1.85752 WP_001124469.1.85762 WP_001124469.1.85767 WP_001124469.1.85772 WP_001124469.1.85773 WP_001124469.1.8579 WP_001124469.1.85793 WP_001124469.1.85800 WP_001124469.1.85857 WP_001124469.1.85895 WP_001124469.1.85939 WP_001124469.1.85944 WP_001124469.1.85948 WP_001124469.1.85969 WP_001124469.1.86 WP_001124469.1.86016 WP_001124469.1.86035 WP_001124469.1.86063 WP_001124469.1.8607 WP_001124469.1.86105 WP_001124469.1.86110 WP_001124469.1.86115 WP_001124469.1.86145 WP_001124469.1.86149 WP_001124469.1.86171 WP_001124469.1.86181 WP_001124469.1.86189 WP_001124469.1.86210 WP_001124469.1.86225 WP_001124469.1.86227 WP_001124469.1.86228 WP_001124469.1.86234 WP_001124469.1.86255 WP_001124469.1.86263 WP_001124469.1.86266 WP_001124469.1.86280 WP_001124469.1.86283 WP_001124469.1.86307 WP_001124469.1.86340 WP_001124469.1.8635 WP_001124469.1.86355 WP_001124469.1.86364 WP_001124469.1.86371 WP_001124469.1.86376 WP_001124469.1.86393 WP_001124469.1.86411 WP_001124469.1.86412 WP_001124469.1.86451 WP_001124469.1.86452 WP_001124469.1.86461 WP_001124469.1.86475 WP_001124469.1.86483 WP_001124469.1.86518 WP_001124469.1.86574 WP_001124469.1.86583 WP_001124469.1.86598 WP_001124469.1.86609 WP_001124469.1.86617 WP_001124469.1.86640 WP_001124469.1.86667 WP_001124469.1.86674 WP_001124469.1.86691 WP_001124469.1.86707 WP_001124469.1.86717 WP_001124469.1.86753 WP_001124469.1.86760 WP_001124469.1.86787 WP_001124469.1.86833 WP_001124469.1.86846 WP_001124469.1.86848 WP_001124469.1.8687 WP_001124469.1.86935 WP_001124469.1.86956 WP_001124469.1.86959 WP_001124469.1.86975 WP_001124469.1.86994 WP_001124469.1.86997 WP_001124469.1.87059 WP_001124469.1.87075 WP_001124469.1.87076 WP_001124469.1.87109 WP_001124469.1.8711 WP_001124469.1.87177 WP_001124469.1.87189 WP_001124469.1.87247 WP_001124469.1.87249 WP_001124469.1.87254 WP_001124469.1.87310 WP_001124469.1.87339 WP_001124469.1.87358 WP_001124469.1.87382 WP_001124469.1.87389 WP_001124469.1.87400 WP_001124469.1.87410 WP_001124469.1.87465 WP_001124469.1.87557 WP_001124469.1.87563 WP_001124469.1.87568 WP_001124469.1.87607 WP_001124469.1.87608 WP_001124469.1.87610 WP_001124469.1.87616 WP_001124469.1.87639 WP_001124469.1.87655 WP_001124469.1.8771 WP_001124469.1.87721 WP_001124469.1.87726 WP_001124469.1.87728 WP_001124469.1.87786 WP_001124469.1.87788 WP_001124469.1.87789 WP_001124469.1.87822 WP_001124469.1.87834 WP_001124469.1.87914 WP_001124469.1.87919 WP_001124469.1.87973 WP_001124469.1.87980 WP_001124469.1.87984 WP_001124469.1.87989 WP_001124469.1.880 WP_001124469.1.88017 WP_001124469.1.88020 WP_001124469.1.88066 WP_001124469.1.88088 WP_001124469.1.88110 WP_001124469.1.88155 WP_001124469.1.88189 WP_001124469.1.88197 WP_001124469.1.88238 WP_001124469.1.88252 WP_001124469.1.88263 WP_001124469.1.88285 WP_001124469.1.88301 WP_001124469.1.88352 WP_001124469.1.88376 WP_001124469.1.88379 WP_001124469.1.88384 WP_001124469.1.88413 WP_001124469.1.8843 WP_001124469.1.88434 WP_001124469.1.88438 WP_001124469.1.88462 WP_001124469.1.88524 WP_001124469.1.88528 WP_001124469.1.88535 WP_001124469.1.88539 WP_001124469.1.8854 WP_001124469.1.88557 WP_001124469.1.88577 WP_001124469.1.88598 WP_001124469.1.88603 WP_001124469.1.88607 WP_001124469.1.88631 WP_001124469.1.88646 WP_001124469.1.88678 WP_001124469.1.88685 WP_001124469.1.88709 WP_001124469.1.88710 WP_001124469.1.88711 WP_001124469.1.88720 WP_001124469.1.88735 WP_001124469.1.88757 WP_001124469.1.88759 WP_001124469.1.8879 WP_001124469.1.88803 WP_001124469.1.88834 WP_001124469.1.88864 WP_001124469.1.88883 WP_001124469.1.88891 WP_001124469.1.88950 WP_001124469.1.88997 WP_001124469.1.89018 WP_001124469.1.89050 WP_001124469.1.8906 WP_001124469.1.89067 WP_001124469.1.89069 WP_001124469.1.89097 WP_001124469.1.89099 WP_001124469.1.89111 WP_001124469.1.89165 WP_001124469.1.89183 WP_001124469.1.89197 WP_001124469.1.89200 WP_001124469.1.89255 WP_001124469.1.8928 WP_001124469.1.89305 WP_001124469.1.89322 WP_001124469.1.8938 WP_001124469.1.89385 WP_001124469.1.894 WP_001124469.1.89400 WP_001124469.1.89403 WP_001124469.1.89405 WP_001124469.1.89416 WP_001124469.1.89432 WP_001124469.1.8945 WP_001124469.1.89468 WP_001124469.1.89474 WP_001124469.1.89479 WP_001124469.1.89492 WP_001124469.1.89496 WP_001124469.1.89510 WP_001124469.1.89569 WP_001124469.1.89601 WP_001124469.1.89605 WP_001124469.1.89630 WP_001124469.1.89646 WP_001124469.1.89656 WP_001124469.1.89674 WP_001124469.1.89679 WP_001124469.1.89710 WP_001124469.1.89768 WP_001124469.1.89781 WP_001124469.1.89818 WP_001124469.1.89839 WP_001124469.1.89841 WP_001124469.1.8985 WP_001124469.1.89852 WP_001124469.1.89859 WP_001124469.1.89895 WP_001124469.1.89899 WP_001124469.1.89918 WP_001124469.1.89920 WP_001124469.1.89925 WP_001124469.1.89927 WP_001124469.1.89959 WP_001124469.1.89977 WP_001124469.1.89988 WP_001124469.1.89998 WP_001124469.1.90017 WP_001124469.1.90063 WP_001124469.1.90065 WP_001124469.1.90078 WP_001124469.1.9009 WP_001124469.1.90115 WP_001124469.1.90128 WP_001124469.1.90139 WP_001124469.1.90146 WP_001124469.1.90156 WP_001124469.1.90182 WP_001124469.1.90205 WP_001124469.1.90219 WP_001124469.1.90249 WP_001124469.1.90257 WP_001124469.1.90266 WP_001124469.1.90270 WP_001124469.1.90314 WP_001124469.1.90332 WP_001124469.1.90342 WP_001124469.1.90349 WP_001124469.1.90358 WP_001124469.1.9036 WP_001124469.1.90389 WP_001124469.1.90405 WP_001124469.1.90435 WP_001124469.1.90436 WP_001124469.1.90441 WP_001124469.1.90449 WP_001124469.1.90467 WP_001124469.1.90511 WP_001124469.1.90536 WP_001124469.1.90547 WP_001124469.1.9059 WP_001124469.1.90591 WP_001124469.1.9061 WP_001124469.1.90626 WP_001124469.1.90690 WP_001124469.1.90703 WP_001124469.1.90706 WP_001124469.1.90758 WP_001124469.1.90799 WP_001124469.1.9081 WP_001124469.1.90813 WP_001124469.1.90822 WP_001124469.1.90828 WP_001124469.1.90834 WP_001124469.1.90837 WP_001124469.1.90839 WP_001124469.1.9084 WP_001124469.1.90848 WP_001124469.1.90856 WP_001124469.1.90864 WP_001124469.1.90865 WP_001124469.1.90873 WP_001124469.1.90890 WP_001124469.1.90951 WP_001124469.1.90967 WP_001124469.1.9098 WP_001124469.1.90997 WP_001124469.1.91018 WP_001124469.1.91072 WP_001124469.1.91088 WP_001124469.1.91094 WP_001124469.1.91113 WP_001124469.1.91117 WP_001124469.1.91138 WP_001124469.1.91153 WP_001124469.1.91170 WP_001124469.1.9118 WP_001124469.1.91266 WP_001124469.1.91268 WP_001124469.1.91277 WP_001124469.1.91288 WP_001124469.1.91290 WP_001124469.1.91340 WP_001124469.1.91341 WP_001124469.1.91356 WP_001124469.1.91384 WP_001124469.1.91397 WP_001124469.1.91414 WP_001124469.1.91462 WP_001124469.1.91485 WP_001124469.1.91511 WP_001124469.1.91516 WP_001124469.1.91548 WP_001124469.1.91551 WP_001124469.1.91565 WP_001124469.1.9157 WP_001124469.1.91594 WP_001124469.1.91596 WP_001124469.1.9160 WP_001124469.1.91630 WP_001124469.1.91640 WP_001124469.1.91643 WP_001124469.1.91644 WP_001124469.1.91651 WP_001124469.1.9168 WP_001124469.1.91685 WP_001124469.1.9169 WP_001124469.1.91701 WP_001124469.1.9171 WP_001124469.1.91739 WP_001124469.1.91777 WP_001124469.1.91779 WP_001124469.1.91782 WP_001124469.1.91787 WP_001124469.1.91793 WP_001124469.1.91801 WP_001124469.1.9185 WP_001124469.1.91850 WP_001124469.1.91863 WP_001124469.1.91871 WP_001124469.1.91951 WP_001124469.1.91959 WP_001124469.1.91971 WP_001124469.1.9199 WP_001124469.1.91994 WP_001124469.1.92005 WP_001124469.1.92014 WP_001124469.1.92019 WP_001124469.1.92029 WP_001124469.1.92031 WP_001124469.1.92048 WP_001124469.1.92058 WP_001124469.1.921 WP_001124469.1.92102 WP_001124469.1.92123 WP_001124469.1.9215 WP_001124469.1.92161 WP_001124469.1.92163 WP_001124469.1.92195 WP_001124469.1.92215 WP_001124469.1.92305 WP_001124469.1.92311 WP_001124469.1.92361 WP_001124469.1.924 WP_001124469.1.92434 WP_001124469.1.92462 WP_001124469.1.92495 WP_001124469.1.92496 WP_001124469.1.92506 WP_001124469.1.92532 WP_001124469.1.92535 WP_001124469.1.9255 WP_001124469.1.92568 WP_001124469.1.92571 WP_001124469.1.92577 WP_001124469.1.92614 WP_001124469.1.92615 WP_001124469.1.92638 WP_001124469.1.9264 WP_001124469.1.9266 WP_001124469.1.92668 WP_001124469.1.92693 WP_001124469.1.92719 WP_001124469.1.92742 WP_001124469.1.92780 WP_001124469.1.92781 WP_001124469.1.92792 WP_001124469.1.92793 WP_001124469.1.92796 WP_001124469.1.92819 WP_001124469.1.92845 WP_001124469.1.92865 WP_001124469.1.92932 WP_001124469.1.92943 WP_001124469.1.92953 WP_001124469.1.92991 WP_001124469.1.93005 WP_001124469.1.93016 WP_001124469.1.93019 WP_001124469.1.93023 WP_001124469.1.93027 WP_001124469.1.93033 WP_001124469.1.93048 WP_001124469.1.93054 WP_001124469.1.93069 WP_001124469.1.93072 WP_001124469.1.93085 WP_001124469.1.93100 WP_001124469.1.93112 WP_001124469.1.93133 WP_001124469.1.93150 WP_001124469.1.93175 WP_001124469.1.93185 WP_001124469.1.93252 WP_001124469.1.93267 WP_001124469.1.9327 WP_001124469.1.93276 WP_001124469.1.93309 WP_001124469.1.93312 WP_001124469.1.93338 WP_001124469.1.93379 WP_001124469.1.93388 WP_001124469.1.93427 WP_001124469.1.93428 WP_001124469.1.93463 WP_001124469.1.93468 WP_001124469.1.93509 WP_001124469.1.93531 WP_001124469.1.93569 WP_001124469.1.93601 WP_001124469.1.93605 WP_001124469.1.93626 WP_001124469.1.93629 WP_001124469.1.93630 WP_001124469.1.93637 WP_001124469.1.93652 WP_001124469.1.93665 WP_001124469.1.93670 WP_001124469.1.93673 WP_001124469.1.93695 WP_001124469.1.93733 WP_001124469.1.93742 WP_001124469.1.93743 WP_001124469.1.93745 WP_001124469.1.93755 WP_001124469.1.938 WP_001124469.1.93800 WP_001124469.1.93821 WP_001124469.1.93873 WP_001124469.1.93877 WP_001124469.1.939 WP_001124469.1.93900 WP_001124469.1.93911 WP_001124469.1.93918 WP_001124469.1.93921 WP_001124469.1.93951 WP_001124469.1.93971 WP_001124469.1.94008 WP_001124469.1.94011 WP_001124469.1.94057 WP_001124469.1.94176 WP_001124469.1.94190 WP_001124469.1.94213 WP_001124469.1.94232 WP_001124469.1.9426 WP_001124469.1.94271 WP_001124469.1.94298 WP_001124469.1.94302 WP_001124469.1.94317 WP_001124469.1.94343 WP_001124469.1.94353 WP_001124469.1.94388 WP_001124469.1.94404 WP_001124469.1.94429 WP_001124469.1.94468 WP_001124469.1.94475 WP_001124469.1.94497 WP_001124469.1.94507 WP_001124469.1.94516 WP_001124469.1.94523 WP_001124469.1.94544 WP_001124469.1.94548 WP_001124469.1.9457 WP_001124469.1.94578 WP_001124469.1.94580 WP_001124469.1.94589 WP_001124469.1.94646 WP_001124469.1.94676 WP_001124469.1.94690 WP_001124469.1.94692 WP_001124469.1.94738 WP_001124469.1.94753 WP_001124469.1.94787 WP_001124469.1.94790 WP_001124469.1.948 WP_001124469.1.94801 WP_001124469.1.94806 WP_001124469.1.94808 WP_001124469.1.94822 WP_001124469.1.94877 WP_001124469.1.94880 WP_001124469.1.94889 WP_001124469.1.9489 WP_001124469.1.949 WP_001124469.1.94903 WP_001124469.1.94935 WP_001124469.1.94938 WP_001124469.1.94949 WP_001124469.1.94963 WP_001124469.1.94991 WP_001124469.1.94993 WP_001124469.1.95005 WP_001124469.1.95011 WP_001124469.1.95022 WP_001124469.1.95028 WP_001124469.1.95035 WP_001124469.1.95036 WP_001124469.1.95037 WP_001124469.1.95062 WP_001124469.1.95129 WP_001124469.1.9513 WP_001124469.1.95161 WP_001124469.1.95198 WP_001124469.1.95233 WP_001124469.1.95243 WP_001124469.1.95244 WP_001124469.1.95254 WP_001124469.1.95275 WP_001124469.1.95332 WP_001124469.1.95390 WP_001124469.1.95400 WP_001124469.1.95403 WP_001124469.1.95431 WP_001124469.1.95438 WP_001124469.1.95521 WP_001124469.1.95563 WP_001124469.1.9559 WP_001124469.1.95595 WP_001124469.1.95596 WP_001124469.1.95604 WP_001124469.1.95611 WP_001124469.1.95655 WP_001124469.1.95712 WP_001124469.1.95756 WP_001124469.1.95759 WP_001124469.1.95771 WP_001124469.1.95800 WP_001124469.1.95801 WP_001124469.1.95821 WP_001124469.1.95824 WP_001124469.1.95827 WP_001124469.1.95834 WP_001124469.1.95835 WP_001124469.1.95849 WP_001124469.1.95865 WP_001124469.1.95869 WP_001124469.1.95916 WP_001124469.1.95932 WP_001124469.1.960 WP_001124469.1.96015 WP_001124469.1.96032 WP_001124469.1.96066 WP_001124469.1.96086 WP_001124469.1.96114 WP_001124469.1.96128 WP_001124469.1.9616 WP_001124469.1.96177 WP_001124469.1.96215 WP_001124469.1.96222 WP_001124469.1.96229 WP_001124469.1.96247 WP_001124469.1.96278 WP_001124469.1.96279 WP_001124469.1.96281 WP_001124469.1.96290 WP_001124469.1.96293 WP_001124469.1.96299 WP_001124469.1.96303 WP_001124469.1.9631 WP_001124469.1.96339 WP_001124469.1.96341 WP_001124469.1.96394 WP_001124469.1.96417 WP_001124469.1.96420 WP_001124469.1.96425 WP_001124469.1.96450 WP_001124469.1.96457 WP_001124469.1.96479 WP_001124469.1.96480 WP_001124469.1.96484 WP_001124469.1.96494 WP_001124469.1.965 WP_001124469.1.96541 WP_001124469.1.96562 WP_001124469.1.9657 WP_001124469.1.96585 WP_001124469.1.96608 WP_001124469.1.9661 WP_001124469.1.96659 WP_001124469.1.96680 WP_001124469.1.96683 WP_001124469.1.96695 WP_001124469.1.96701 WP_001124469.1.96725 WP_001124469.1.96743 WP_001124469.1.96753 WP_001124469.1.96769 WP_001124469.1.96779 WP_001124469.1.96796 WP_001124469.1.96817 WP_001124469.1.96850 WP_001124469.1.9690 WP_001124469.1.9691 WP_001124469.1.96924 WP_001124469.1.96932 WP_001124469.1.96936 WP_001124469.1.96944 WP_001124469.1.96984 WP_001124469.1.96989 WP_001124469.1.97011 WP_001124469.1.97027 WP_001124469.1.97049 WP_001124469.1.97059 WP_001124469.1.9708 WP_001124469.1.97119 WP_001124469.1.97123 WP_001124469.1.97193 WP_001124469.1.97195 WP_001124469.1.97200 WP_001124469.1.97238 WP_001124469.1.97248 WP_001124469.1.97279 WP_001124469.1.9729 WP_001124469.1.97344 WP_001124469.1.97351 WP_001124469.1.97356 WP_001124469.1.97360 WP_001124469.1.97361 WP_001124469.1.9740 WP_001124469.1.97402 WP_001124469.1.97418 WP_001124469.1.97421 WP_001124469.1.97434 WP_001124469.1.97439 WP_001124469.1.97459 WP_001124469.1.97490 WP_001124469.1.97502 WP_001124469.1.97513 WP_001124469.1.97527 WP_001124469.1.97538 WP_001124469.1.97544 WP_001124469.1.97560 WP_001124469.1.97571 WP_001124469.1.97619 WP_001124469.1.97632 WP_001124469.1.97667 WP_001124469.1.97675 WP_001124469.1.97685 WP_001124469.1.9770 WP_001124469.1.97705 WP_001124469.1.97711 WP_001124469.1.97775 WP_001124469.1.97789 WP_001124469.1.97798 WP_001124469.1.97802 WP_001124469.1.97815 WP_001124469.1.97822 WP_001124469.1.97871 WP_001124469.1.97895 WP_001124469.1.97930 WP_001124469.1.97932 WP_001124469.1.97937 WP_001124469.1.97996 WP_001124469.1.98012 WP_001124469.1.98026 WP_001124469.1.9803 WP_001124469.1.98046 WP_001124469.1.98082 WP_001124469.1.98083 WP_001124469.1.981 WP_001124469.1.98115 WP_001124469.1.98139 WP_001124469.1.98155 WP_001124469.1.9816 WP_001124469.1.9817 WP_001124469.1.98176 WP_001124469.1.98187 WP_001124469.1.98202 WP_001124469.1.98205 WP_001124469.1.98208 WP_001124469.1.98220 WP_001124469.1.98232 WP_001124469.1.98235 WP_001124469.1.98239 WP_001124469.1.98241 WP_001124469.1.98279 WP_001124469.1.98284 WP_001124469.1.98292 WP_001124469.1.98294 WP_001124469.1.98301 WP_001124469.1.98312 WP_001124469.1.98323 WP_001124469.1.98355 WP_001124469.1.98357 WP_001124469.1.98384 WP_001124469.1.98400 WP_001124469.1.98404 WP_001124469.1.98424 WP_001124469.1.9844 WP_001124469.1.98451 WP_001124469.1.98477 WP_001124469.1.98498 WP_001124469.1.98543 WP_001124469.1.98549 WP_001124469.1.98569 WP_001124469.1.98578 WP_001124469.1.9858 WP_001124469.1.98587 WP_001124469.1.98603 WP_001124469.1.98614 WP_001124469.1.98628 WP_001124469.1.9864 WP_001124469.1.98641 WP_001124469.1.98665 WP_001124469.1.98668 WP_001124469.1.98683 WP_001124469.1.98702 WP_001124469.1.98776 WP_001124469.1.9883 WP_001124469.1.98849 WP_001124469.1.98875 WP_001124469.1.98886 WP_001124469.1.98908 WP_001124469.1.98920 WP_001124469.1.98976 WP_001124469.1.98988 WP_001124469.1.99029 WP_001124469.1.99046 WP_001124469.1.99053 WP_001124469.1.9907 WP_001124469.1.99101 WP_001124469.1.99110 WP_001124469.1.99119 WP_001124469.1.99168 WP_001124469.1.99182 WP_001124469.1.99209 WP_001124469.1.99234 WP_001124469.1.99246 WP_001124469.1.99265 WP_001124469.1.99292 WP_001124469.1.99295 WP_001124469.1.99302 WP_001124469.1.99304 WP_001124469.1.99310 WP_001124469.1.99319 WP_001124469.1.99334 WP_001124469.1.99345 WP_001124469.1.99361 WP_001124469.1.9940 WP_001124469.1.99400 WP_001124469.1.99427 WP_001124469.1.99446 WP_001124469.1.99453 WP_001124469.1.99471 WP_001124469.1.99475 WP_001124469.1.99486 WP_001124469.1.99487 WP_001124469.1.99501 WP_001124469.1.99511 WP_001124469.1.99534 WP_001124469.1.99562 WP_001124469.1.99592 WP_001124469.1.99602 WP_001124469.1.99603 WP_001124469.1.99619 WP_001124469.1.99632 WP_001124469.1.99641 WP_001124469.1.99666 WP_001124469.1.99692 WP_001124469.1.99774 WP_001124469.1.99791 WP_001124469.1.99827 WP_001124469.1.99869 WP_001124469.1.99892 WP_001124469.1.99912 WP_001124469.1.99929 WP_001124469.1.99986 YP_002408664.1.10275 YP_006778066.1.12065 gi|238901690|ref|YP_002927486.1| gi|387622225|ref|YP_006129853.1| gi|384544142|ref|YP_005728205.1| gi|471334197|ref|YP_007557674.1| gi|30063915|ref|NP_838086.1| FER_ECO57 gi|157162000|ref|YP_001459318.1| gi|254794475|ref|YP_003079312.1| gi|74313051|ref|YP_311470.1| gi|170681073|ref|YP_001744713.1| gi|254162499|ref|YP_003045607.1| gi|16130450|ref|NP_417020.1| gi|386615230|ref|YP_006134896.1| gi|218701035|ref|YP_002408664.1| gi|386710415|ref|YP_006174136.1| gi|110806456|ref|YP_689976.1| 1i7h_A 1i7h_B 1i7h_C gi|386710415|ref|YP_006174136.1| gi|251785852|ref|YP_003000156.1| gi|383179535|ref|YP_005457540.1| gi|209920002|ref|YP_002294086.1| gi|388478561|ref|YP_490753.1| gi|187734044|ref|YP_001881316.1| gi|260856619|ref|YP_003230510.1| gi|544391089|ref|YP_008565669.1| 1i7hA gi|407470421|ref|YP_006783136.1| gi|15832645|ref|NP_311418.1| gi|170082135|ref|YP_001731455.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]