SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YDR235W from Saccharomyces cerevisiae AWRI796

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YDR235W
Domain Number 1 Region: 20-204
Classification Level Classification E-value
Superfamily TPR-like 1.3e-16
Family HAT/Suf repeat 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) YDR235W
Sequence length 249
Comment PRP42 ORF Verified U1 snRNP protein involved in splicing, required for U1 snRNP biogenesis; contains multiple tetriatricopeptide repeats
Sequence
MDKYTALIHDENFSTLTLNVSRYPKSLAYWEKLLNYIVKASAPICKSTEPQLLKLIRCTY
SSMLNEFPYLENYYIDFALLEYKLGNVSMSHKIFQRGLQAFNQRSLLLWTSYLKFCNNVI
SHQKQLFKKYETAEEYVGLHFFSGEFWDLYLEQISSRCTSSKKYWNVLRKILEIPLHSFS
KFYALWLQRIDDIMDLKQLSQLTSKDELLKKLKIDINYSGRKGPYLQDAKKKVEENNEGN
VHGCTISST
Download sequence
Identical sequences YDR235W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]