SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|512683582|ref|YP_008111562.1| from Pseudomonas putida NBRC 14164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|512683582|ref|YP_008111562.1|
Domain Number 1 Region: 4-213
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 8.63e-51
Family Formate dehydrogenase N, cytochrome (gamma) subunit 0.00000272
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|512683582|ref|YP_008111562.1|
Sequence length 218
Comment formate dehydrogenase gamma subunit [Pseudomonas putida NBRC 14164]
Sequence
MNDNKPILRYNANERTNHWIVAILFFMAGLSGLALFHPALFWLSHLFGGGPWTRILHPFM
GVAMFVFFLGLVFRFWRANFITANDRLWLRRIDRVMVNREDGVPPIGKYNAGQKLLFWTL
LLCMLVLLISGVVIWRAYFSHFFDIGSIRLASLAHALAGFVLILSIIVHIYAGIWIKGSI
GAMLHGWVSRAWARKHHALWYREVTGDKTPGNHGRKEG
Download sequence
Identical sequences A0A132GEF9 A0A166ITA9
gi|512683582|ref|YP_008111562.1| WP_016497755.1.76632 WP_016497755.1.7826 WP_016497755.1.87386 WP_016497755.1.96571

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]