SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|512685989|ref|YP_008113969.1| from Pseudomonas putida NBRC 14164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|512685989|ref|YP_008113969.1|
Domain Number 1 Region: 3-175
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 1.1e-30
Family Formate dehydrogenase N, cytochrome (gamma) subunit 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|512685989|ref|YP_008113969.1|
Sequence length 177
Comment putative cytochrome b561 [Pseudomonas putida NBRC 14164]
Sequence
MKPEAFHPFARLLHWLMAVLILAMLFIGVSMVADLSLRHPVLIGLHKATGLALLVLVVLR
IGVRLAVPHPPLPRDLPTLQRWAAGASHLLLYGLMLAMPLLGWAMLSAGDYPRPLGLPAI
APHNLQLYAVLRLAHGWAGYLLFATVLVHVGAALMHAWVRRDGVLRSMWPGPLRRSE
Download sequence
Identical sequences A0A132GEE9 A0A1X0ZLB0
gi|512685989|ref|YP_008113969.1| WP_016499998.1.62999 WP_016499998.1.66754 WP_016499998.1.76632 WP_016499998.1.7826 WP_016499998.1.96571

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]