SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|512686882|ref|YP_008114862.1| from Pseudomonas putida NBRC 14164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|512686882|ref|YP_008114862.1|
Domain Number 1 Region: 6-179
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 2.12e-29
Family Formate dehydrogenase N, cytochrome (gamma) subunit 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|512686882|ref|YP_008114862.1|
Sequence length 181
Comment putative cytochrome b561 [Pseudomonas putida NBRC 14164]
Sequence
MVSSTPTTHYARLSIALHWLMLVLLAAVYALIELRGLFPKDSAERNLMKDLHFMLGLSVF
VLVWLRLAMRLSRPTPPIVPKPPAWQTGLAHLMHLALYLLMIGMPLAGWLILSAADKPVP
FFGLELPHLIGPDPDQAKFIKGWHERVGSWGYWLIGLHAVAGLYHHYVQRDNTLLRMLPY
K
Download sequence
Identical sequences A0A132G4R8 A0A1X0Z984
WP_016500850.1.62999 WP_016500850.1.66754 WP_016500850.1.76632 WP_016500850.1.7826 WP_016500850.1.96571 gi|512686882|ref|YP_008114862.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]