SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YGR083C from Saccharomyces cerevisiae CBS7960

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YGR083C
Domain Number 1 Region: 269-554,596-647
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 7.18e-86
Family IF2B-like 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) YGR083C
Sequence length 651
Comment GCD2 ORF Verified Delta subunit of the translation initiation factor eIF2B, the guanine-nucleotide exchange factor for eIF2; activity subsequently regulated by phosphorylated eIF2; first identified as a negative regulator of GCN4 expression
Sequence
MSESEAKSRSATPPSKAKQATPTTTAAANGEKKLTNKELKELKKQEKAAKRAAMKQANGI
SIEQQQQQAQMKKEKKQLQREQQQKREQKQKNANKKKQNERNVKKSTLFGHLETTEERRA
TILALTSAVSSPKTSRITAAGLMVPVVASALSGSNVLTASSLMPVGPNASSTVSASAPAS
TTTTLPASSAALSAGTSSASTNTPTAIQQEIASSNASDVAKTLASISLEAGEFNVIPGIS
SVIPTVLEQSFDNSSLVSSVKELLLNKDLIHPSILLLTSHLAHYKIVGSIPRCIAMLEVF
QIVIKDYQTPKGTTLSRNLTSYLSHQIDLLKKARPLSVTMGNAIRWLKQEISLIDPSTPD
KAAKKDLCEKIGQFAKEKIELADQLIIDNASTQIEESTTIVTYGSSKVLTELLLHNAISL
KKNIKVIVIDSRPLFEGRKMAETLRNAGVNVMYALITSLDTIFNMDVDYVFLGAHSILSN
GFLYSRAGTAMLAMSAKRRNIPVLVCCESLKFSQRVQLDSVTFNELADPNDLVNIDYENP
IERRGNKGALLNQFIKERKFEKKKLAMENKPKGNKIGGKKGSEGESKDASNEEDSNSKNI
LDGWQELPSLNIVNILYDLTPPEYIKKVITEFGALPPSSVPVILREYKGSA
Download sequence
Identical sequences C7GXR2
YGR083C YGR083C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]