SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YOR051C from Saccharomyces cerevisiae CBS7960

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  YOR051C
Domain Number - Region: 273-311,338-375
Classification Level Classification E-value
Superfamily TPR-like 0.0948
Family Tetratricopeptide repeat (TPR) 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) YOR051C
Sequence length 412
Comment ETT1 ORF Verified Nuclear protein that inhibits replication of Brome mosaic virus in S. cerevisiae, which is a model system for studying replication of positive-strand RNA viruses in their natural hosts; deletion increases stop codon readthrough
Sequence
MAKRPLGLGKQSREKKRKVESVEKKSDEPSRESTPVRSQMSVELDDDADLDDELAQLKGL
WSKYFHSDRDDEYVLNGIVHECDRLLRLSEEDKEIKKTLNDIFHGIYALALSELTIFKAG
DEEATEEKRKKDVSSFFENAIERVELGLSHFPESQFLKLVLAKIIFQRIPLEYISNLHLK
SKDKKLDLVGQLEHGKKHFSIYENDTEFTFEILQMVNDLLDIVENFGREQSIQEGIDSDN
EEEEELIDIELEPEHPVYPLQQSLEANYEWLRNHFDKLLDNTNTDMKIYASIANTLGELY
LKKAEEPSKVFLSLQYDDGGSKKVSDKEAKNVQETALKHTKKALEYLEKAKLEDDPDTWV
QVAEAYIDLGNLLDNESAEQEEAYKTAEEILGKANKASHGKFQDVLDNFLQG
Download sequence
Identical sequences YOR051C YOR051C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]